MELO3C008538.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: five_prime_UTRexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.AAATTGCACCATCAGATATTGTTCGTTCCAATTGTACTATTGCTTTAGGAGATTTGGCAGTTTGTTTCCCTAATCTCTTGGAGCCATGGACCGAGAATATGTATACAAGGTTGAAGGATCCTTCAAATTCTGTTAGGAAGAATGTTGTATTGGAGCTATCTCATCTCATTTTCAACGATATTATGAAGGCTTGA AAATTGCACCATCAGATATTGTTCGTTCCAATTGTACTATTGCTTTAGGAGATTTGGCAGTTTGTTTCCCTAATCTCTTGGAGCCATGGACCGAGAATATGTATACAAGGTTGAAGGATCCTTCAAATTCTGTTAGGAAGAATGTTGTATTGGAGCTATCTCATCTCATTTTCAACGATATTATGAAGGCTTGA ATTGCACCATCAGATATTGTTCGTTCCAATTGTACTATTGCTTTAGGAGATTTGGCAGTTTGTTTCCCTAATCTCTTGGAGCCATGGACCGAGAATATGTATACAAGGTTGAAGGATCCTTCAAATTCTGTTAGGAAGAATGTTGTATTGGAGCTATCTCATCTCATTTTCAACGATATTATGAAGGCTTGA IAPSDIVRSNCTIALGDLAVCFPNLLEPWTENMYTRLKDPSNSVRKNVVLELSHLIFNDIMKA
BLAST of MELO3C008538.2 vs. NCBI nr
Match: XP_022935076.1 (condensin complex subunit 1 [Cucurbita moschata]) HSP 1 Score: 114.0 bits (284), Expect = 1.9e-22 Identity = 55/61 (90.16%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of MELO3C008538.2 vs. NCBI nr
Match: XP_022983683.1 (condensin complex subunit 1 [Cucurbita maxima]) HSP 1 Score: 114.0 bits (284), Expect = 1.9e-22 Identity = 55/61 (90.16%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of MELO3C008538.2 vs. NCBI nr
Match: XP_023527692.1 (condensin complex subunit 1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 114.0 bits (284), Expect = 1.9e-22 Identity = 55/61 (90.16%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of MELO3C008538.2 vs. NCBI nr
Match: XP_022158546.1 (condensin complex subunit 1 [Momordica charantia] >XP_022158547.1 condensin complex subunit 1 [Momordica charantia]) HSP 1 Score: 112.5 bits (280), Expect = 5.4e-22 Identity = 54/61 (88.52%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of MELO3C008538.2 vs. NCBI nr
Match: XP_008443280.1 (PREDICTED: condensin complex subunit 1 [Cucumis melo]) HSP 1 Score: 111.3 bits (277), Expect = 1.2e-21 Identity = 54/61 (88.52%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of MELO3C008538.2 vs. TAIR10
Match: AT3G57060.2 (binding) HSP 1 Score: 103.2 bits (256), Expect = 5.9e-23 Identity = 48/61 (78.69%), Postives = 54/61 (88.52%), Query Frame = 0
BLAST of MELO3C008538.2 vs. Swiss-Prot
Match: sp|Q9YHY6|CND1_XENLA (Condensin complex subunit 1 OS=Xenopus laevis OX=8355 GN=ncapd2 PE=1 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 4.8e-14 Identity = 34/61 (55.74%), Postives = 45/61 (73.77%), Query Frame = 0
BLAST of MELO3C008538.2 vs. Swiss-Prot
Match: sp|Q15021|CND1_HUMAN (Condensin complex subunit 1 OS=Homo sapiens OX=9606 GN=NCAPD2 PE=1 SV=3) HSP 1 Score: 75.1 bits (183), Expect = 3.1e-13 Identity = 32/61 (52.46%), Postives = 45/61 (73.77%), Query Frame = 0
BLAST of MELO3C008538.2 vs. Swiss-Prot
Match: sp|Q8K2Z4|CND1_MOUSE (Condensin complex subunit 1 OS=Mus musculus OX=10090 GN=Ncapd2 PE=1 SV=2) HSP 1 Score: 71.6 bits (174), Expect = 3.4e-12 Identity = 30/56 (53.57%), Postives = 42/56 (75.00%), Query Frame = 0
BLAST of MELO3C008538.2 vs. Swiss-Prot
Match: sp|Q06156|CND1_YEAST (Condensin complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YCS4 PE=1 SV=1) HSP 1 Score: 49.3 bits (116), Expect = 1.8e-05 Identity = 21/55 (38.18%), Postives = 36/55 (65.45%), Query Frame = 0
BLAST of MELO3C008538.2 vs. Swiss-Prot
Match: sp|O94679|CND1_SCHPO (Condensin complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cnd1 PE=1 SV=1) HSP 1 Score: 46.6 bits (109), Expect = 1.2e-04 Identity = 21/51 (41.18%), Postives = 32/51 (62.75%), Query Frame = 0
BLAST of MELO3C008538.2 vs. TrEMBL
Match: tr|A0A1S3B7M0|A0A1S3B7M0_CUCME (Condensin complex subunit 1 OS=Cucumis melo OX=3656 GN=LOC103486899 PE=3 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 7.9e-22 Identity = 54/61 (88.52%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of MELO3C008538.2 vs. TrEMBL
Match: tr|A0A0B0N4S7|A0A0B0N4S7_GOSAR (Condensin complex subunit 1 OS=Gossypium arboreum OX=29729 GN=F383_00490 PE=3 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 2.3e-21 Identity = 53/61 (86.89%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of MELO3C008538.2 vs. TrEMBL
Match: tr|A0A1U8N1R8|A0A1U8N1R8_GOSHI (Condensin complex subunit 1 OS=Gossypium hirsutum OX=3635 GN=LOC107942588 PE=3 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 2.3e-21 Identity = 53/61 (86.89%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of MELO3C008538.2 vs. TrEMBL
Match: tr|A0A1U8N1V6|A0A1U8N1V6_GOSHI (Condensin complex subunit 1 OS=Gossypium hirsutum OX=3635 GN=LOC107942588 PE=3 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 2.3e-21 Identity = 53/61 (86.89%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of MELO3C008538.2 vs. TrEMBL
Match: tr|A0A2P5XMZ8|A0A2P5XMZ8_GOSBA (Condensin complex subunit 1 OS=Gossypium barbadense OX=3634 GN=GOBAR_AA15971 PE=3 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 2.3e-21 Identity = 53/61 (86.89%), Postives = 55/61 (90.16%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|