MELO3C008302 (gene) Melon (DHL92) v3.5.1

NameMELO3C008302
Typegene
OrganismCucumis melo (Melon (DHL92) v3.5.1)
DescriptionTrk system potassium uptake protein TrkA
Locationchr3 : 3295365 .. 3295538 (-)
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGGCGTTGCTACTCGACAGAACGACACGACAGAAGACGACACGGAATGAAGAGTCAGTACGATCGACGAATGACGGAGGAGACAAGCGGCTCGTAAAGGGTCACGGTGTTTTGGACGAAAACACAGCGAAAGACGACGGAGAAAGAAACCAATGGCAGTGGAGATGGTGGTGA

mRNA sequence

ATGGCGTTGCTACTCGACAGAACGACACGACAGAAGACGACACGGAATGAAGAGTCAGTACGATCGACGAATGACGGAGGAGACAAGCGGCTCGTAAAGGGTCACGGTGTTTTGGACGAAAACACAGCGAAAGACGACGGAGAAAGAAACCAATGGCAGTGGAGATGGTGGTGA

Coding sequence (CDS)

ATGGCGTTGCTACTCGACAGAACGACACGACAGAAGACGACACGGAATGAAGAGTCAGTACGATCGACGAATGACGGAGGAGACAAGCGGCTCGTAAAGGGTCACGGTGTTTTGGACGAAAACACAGCGAAAGACGACGGAGAAAGAAACCAATGGCAGTGGAGATGGTGGTGA

Protein sequence

MALLLDRTTRQKTTRNEESVRSTNDGGDKRLVKGHGVLDENTAKDDGERNQWQWRWW*
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008150 biological_process
cellular_component GO:0005575 cellular_component
molecular_function GO:0003674 molecular_function

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
MELO3C008302T1MELO3C008302T1mRNA


The following gene(s) are orthologous to this gene:

None

The following gene(s) are paralogous to this gene:

None

The following block(s) are covering this gene:
GeneOrganismBlock
MELO3C008302Cucurbita maxima (Rimu)cmameB267
MELO3C008302Cucurbita maxima (Rimu)cmameB598
MELO3C008302Cucurbita maxima (Rimu)cmameB679
MELO3C008302Cucurbita maxima (Rimu)cmameB682
MELO3C008302Cucurbita maxima (Rimu)cmameB683
MELO3C008302Cucurbita maxima (Rimu)cmameB785
MELO3C008302Cucurbita moschata (Rifu)cmomeB258
MELO3C008302Cucurbita moschata (Rifu)cmomeB589
MELO3C008302Cucurbita moschata (Rifu)cmomeB671
MELO3C008302Cucurbita moschata (Rifu)cmomeB675
MELO3C008302Wild cucumber (PI 183967)cpimeB282
MELO3C008302Wild cucumber (PI 183967)cpimeB465
MELO3C008302Cucumber (Chinese Long) v2cumeB292
MELO3C008302Cucumber (Chinese Long) v2cumeB467
MELO3C008302Watermelon (Charleston Gray)mewcgB272
MELO3C008302Watermelon (Charleston Gray)mewcgB285
MELO3C008302Watermelon (97103) v1mewmB325
MELO3C008302Watermelon (97103) v1mewmB328
MELO3C008302Cucurbita pepo (Zucchini)cpemeB167
MELO3C008302Cucurbita pepo (Zucchini)cpemeB403
MELO3C008302Cucurbita pepo (Zucchini)cpemeB400
MELO3C008302Bottle gourd (USVL1VR-Ls)lsimeB133
MELO3C008302Bottle gourd (USVL1VR-Ls)lsimeB259
MELO3C008302Cucumber (Gy14) v2cgybmeB244
MELO3C008302Cucumber (Gy14) v2cgybmeB407
MELO3C008302Silver-seed gourdcarmeB0023
MELO3C008302Silver-seed gourdcarmeB0267
MELO3C008302Silver-seed gourdcarmeB0559
MELO3C008302Silver-seed gourdcarmeB0582
MELO3C008302Silver-seed gourdcarmeB0665
MELO3C008302Cucumber (Chinese Long) v3cucmeB289
MELO3C008302Cucumber (Chinese Long) v3cucmeB476
MELO3C008302Watermelon (97103) v2mewmbB282
MELO3C008302Watermelon (97103) v2mewmbB290
MELO3C008302Wax gourdmewgoB341
MELO3C008302Melon (DHL92) v3.5.1memeB069
MELO3C008302Cucumber (Gy14) v1cgymeB221