MELO3C008301 (gene) Melon (DHL92) v3.5.1

NameMELO3C008301
Typegene
OrganismCucumis melo (Melon (DHL92) v3.5.1)
DescriptionFibronectin type III domain containing protein 3C1
Locationchr3 : 3287294 .. 3287503 (+)
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGGAGGGTGGACAACTAGGTGAAATTTCGACAAATGAGCTAGAAATCGGCTATGAATGCAAAGAGCCAAAGAAGGACGTGGGATGGGGGTTAGACGATGAAGAAGGTGGGATGGGATTCGAGACTTGGAGCTACGAAGTGAAGTCTACGAAGTGTCGATTGTGGAAGAAGGATGTGGGATGGGATTTGAGTGTGGATTGGGAGCGCTGA

mRNA sequence

ATGGAGGGTGGACAACTAGGTGAAATTTCGACAAATGAGCTAGAAATCGGCTATGAATGCAAAGAGCCAAAGAAGGACGTGGGATGGGGGTTAGACGATGAAGAAGGTGGGATGGGATTCGAGACTTGGAGCTACGAAGTGAAGTCTACGAAGTGTCGATTGTGGAAGAAGGATGTGGGATGGGATTTGAGTGTGGATTGGGAGCGCTGA

Coding sequence (CDS)

ATGGAGGGTGGACAACTAGGTGAAATTTCGACAAATGAGCTAGAAATCGGCTATGAATGCAAAGAGCCAAAGAAGGACGTGGGATGGGGGTTAGACGATGAAGAAGGTGGGATGGGATTCGAGACTTGGAGCTACGAAGTGAAGTCTACGAAGTGTCGATTGTGGAAGAAGGATGTGGGATGGGATTTGAGTGTGGATTGGGAGCGCTGA

Protein sequence

MEGGQLGEISTNELEIGYECKEPKKDVGWGLDDEEGGMGFETWSYEVKSTKCRLWKKDVGWDLSVDWER*
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008150 biological_process
cellular_component GO:0005575 cellular_component
molecular_function GO:0003674 molecular_function

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
MELO3C008301T1MELO3C008301T1mRNA


The following gene(s) are orthologous to this gene:

None

The following gene(s) are paralogous to this gene:

None

The following block(s) are covering this gene:
GeneOrganismBlock
MELO3C008301Silver-seed gourdcarmeB0023
MELO3C008301Silver-seed gourdcarmeB0267
MELO3C008301Silver-seed gourdcarmeB0559
MELO3C008301Silver-seed gourdcarmeB0582
MELO3C008301Silver-seed gourdcarmeB0665
MELO3C008301Cucumber (Chinese Long) v3cucmeB289
MELO3C008301Cucumber (Chinese Long) v3cucmeB476
MELO3C008301Watermelon (97103) v2mewmbB282
MELO3C008301Watermelon (97103) v2mewmbB290
MELO3C008301Wax gourdmewgoB341
MELO3C008301Melon (DHL92) v3.5.1memeB069
MELO3C008301Cucumber (Gy14) v1cgymeB221
MELO3C008301Cucurbita maxima (Rimu)cmameB267
MELO3C008301Cucurbita maxima (Rimu)cmameB598
MELO3C008301Cucurbita maxima (Rimu)cmameB679
MELO3C008301Cucurbita maxima (Rimu)cmameB682
MELO3C008301Cucurbita maxima (Rimu)cmameB683
MELO3C008301Cucurbita maxima (Rimu)cmameB785
MELO3C008301Cucurbita moschata (Rifu)cmomeB258
MELO3C008301Cucurbita moschata (Rifu)cmomeB589
MELO3C008301Cucurbita moschata (Rifu)cmomeB671
MELO3C008301Cucurbita moschata (Rifu)cmomeB675
MELO3C008301Wild cucumber (PI 183967)cpimeB282
MELO3C008301Wild cucumber (PI 183967)cpimeB465
MELO3C008301Cucumber (Chinese Long) v2cumeB292
MELO3C008301Cucumber (Chinese Long) v2cumeB467
MELO3C008301Watermelon (Charleston Gray)mewcgB272
MELO3C008301Watermelon (Charleston Gray)mewcgB285
MELO3C008301Watermelon (97103) v1mewmB325
MELO3C008301Watermelon (97103) v1mewmB328
MELO3C008301Cucurbita pepo (Zucchini)cpemeB167
MELO3C008301Cucurbita pepo (Zucchini)cpemeB403
MELO3C008301Cucurbita pepo (Zucchini)cpemeB400
MELO3C008301Bottle gourd (USVL1VR-Ls)lsimeB133
MELO3C008301Bottle gourd (USVL1VR-Ls)lsimeB259
MELO3C008301Cucumber (Gy14) v2cgybmeB244
MELO3C008301Cucumber (Gy14) v2cgybmeB407