MELO3C008196 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAATGGGAAGTGAGGGAGAAATTTACATTGGTGGAATTGGCGGAGAGGGAAGGAAAGATCGAAGAGTTTGTAGTGACGAAAGAGGAAATGGAGATGTACGTTGATCTTCATCCATTGACGAACACTACGTCGTATACAGTAATGGAAAGTATGTCGGTGGCAAAAGCTCTGGTTCTTTTTCGGCAAGTAGGGATTCGTCATTTATTGATCGTCCCCAAATATGAAGCAGCCAGAGTAAGCTCATCATCTTCTTCTTCTTCTTCTTCTTTTACTCACTCCATCAGAATTATTTTAGTTCATGGTTGTTTGTGCAGGTTCTGTTGGTGATTGGGATTTTGACGTGGCAAGATTTAAGGTCATACAATATTTTGAGTGCAATTCCTGATTTAGAAAGGACCAAAGGCAATGAGAAACATAATTGA ATGGAATGGGAAGTGAGGGAGAAATTTACATTGGTGGAATTGGCGGAGAGGGAAGGAAAGATCGAAGAGTTTGTAGTGACGAAAGAGGAAATGGAGATGTACGTTGATCTTCATCCATTGACGAACACTACGTCGTATACAGTAATGGAAAGTATGTCGGTGGCAAAAGCTCTGGTTCTTTTTCGGCAAGTAGGGATTCGTCATTTATTGATCGTCCCCAAATATGAAGCAGCCAGAGTTCTGTTGGTGATTGGGATTTTGACGTGGCAAGATTTAAGGTCATACAATATTTTGAGTGCAATTCCTGATTTAGAAAGGACCAAAGGCAATGAGAAACATAATTGA ATGGAATGGGAAGTGAGGGAGAAATTTACATTGGTGGAATTGGCGGAGAGGGAAGGAAAGATCGAAGAGTTTGTAGTGACGAAAGAGGAAATGGAGATGTACGTTGATCTTCATCCATTGACGAACACTACGTCGTATACAGTAATGGAAAGTATGTCGGTGGCAAAAGCTCTGGTTCTTTTTCGGCAAGTAGGGATTCGTCATTTATTGATCGTCCCCAAATATGAAGCAGCCAGAGTTCTGTTGGTGATTGGGATTTTGACGTGGCAAGATTTAAGGTCATACAATATTTTGAGTGCAATTCCTGATTTAGAAAGGACCAAAGGCAATGAGAAACATAATTGA MEWEVREKFTLVELAEREGKIEEFVVTKEEMEMYVDLHPLTNTTSYTVMESMSVAKALVLFRQVGIRHLLIVPKYEAARVLLVIGILTWQDLRSYNILSAIPDLERTKGNEKHN*
BLAST of MELO3C008196 vs. Swiss-Prot
Match: CLCB_ARATH (Chloride channel protein CLC-b OS=Arabidopsis thaliana GN=CLC-B PE=1 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 1.5e-37 Identity = 78/112 (69.64%), Postives = 89/112 (79.46%), Query Frame = 1
BLAST of MELO3C008196 vs. Swiss-Prot
Match: CLCA_ARATH (Chloride channel protein CLC-a OS=Arabidopsis thaliana GN=CLC-A PE=1 SV=2) HSP 1 Score: 149.4 bits (376), Expect = 2.3e-35 Identity = 73/110 (66.36%), Postives = 87/110 (79.09%), Query Frame = 1
BLAST of MELO3C008196 vs. Swiss-Prot
Match: CLCG_ARATH (Putative chloride channel-like protein CLC-g OS=Arabidopsis thaliana GN=CBSCLC6 PE=3 SV=2) HSP 1 Score: 92.4 bits (228), Expect = 3.4e-18 Identity = 46/92 (50.00%), Postives = 64/92 (69.57%), Query Frame = 1
BLAST of MELO3C008196 vs. Swiss-Prot
Match: CLCC_ARATH (Chloride channel protein CLC-c OS=Arabidopsis thaliana GN=CLC-C PE=1 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 5.8e-18 Identity = 44/89 (49.44%), Postives = 62/89 (69.66%), Query Frame = 1
BLAST of MELO3C008196 vs. Swiss-Prot
Match: CLCD_ARATH (Chloride channel protein CLC-d OS=Arabidopsis thaliana GN=CLC-D PE=1 SV=2) HSP 1 Score: 65.5 bits (158), Expect = 4.4e-10 Identity = 33/72 (45.83%), Postives = 45/72 (62.50%), Query Frame = 1
BLAST of MELO3C008196 vs. TrEMBL
Match: I1Z8C8_CUCSA (Chloride channel protein OS=Cucumis sativus GN=ClCa PE=2 SV=1) HSP 1 Score: 189.9 bits (481), Expect = 1.7e-45 Identity = 98/113 (86.73%), Postives = 101/113 (89.38%), Query Frame = 1
BLAST of MELO3C008196 vs. TrEMBL
Match: A0A067DK14_CITSI (Chloride channel protein (Fragment) OS=Citrus sinensis GN=CISIN_1g0039662mg PE=3 SV=1) HSP 1 Score: 177.2 bits (448), Expect = 1.2e-41 Identity = 87/112 (77.68%), Postives = 99/112 (88.39%), Query Frame = 1
BLAST of MELO3C008196 vs. TrEMBL
Match: A0A067DXH7_CITSI (Chloride channel protein OS=Citrus sinensis GN=CISIN_1g0039662mg PE=3 SV=1) HSP 1 Score: 177.2 bits (448), Expect = 1.2e-41 Identity = 87/112 (77.68%), Postives = 99/112 (88.39%), Query Frame = 1
BLAST of MELO3C008196 vs. TrEMBL
Match: V4W2Z9_9ROSI (Chloride channel protein OS=Citrus clementina GN=CICLE_v10014341mg PE=3 SV=1) HSP 1 Score: 174.9 bits (442), Expect = 5.8e-41 Identity = 86/112 (76.79%), Postives = 98/112 (87.50%), Query Frame = 1
BLAST of MELO3C008196 vs. TrEMBL
Match: V4U882_9ROSI (Chloride channel protein OS=Citrus clementina GN=CICLE_v10014341mg PE=3 SV=1) HSP 1 Score: 174.9 bits (442), Expect = 5.8e-41 Identity = 86/112 (76.79%), Postives = 98/112 (87.50%), Query Frame = 1
BLAST of MELO3C008196 vs. TAIR10
Match: AT3G27170.1 (AT3G27170.1 chloride channel B) HSP 1 Score: 156.8 bits (395), Expect = 8.2e-39 Identity = 78/112 (69.64%), Postives = 89/112 (79.46%), Query Frame = 1
BLAST of MELO3C008196 vs. TAIR10
Match: AT5G40890.1 (AT5G40890.1 chloride channel A) HSP 1 Score: 149.4 bits (376), Expect = 1.3e-36 Identity = 73/110 (66.36%), Postives = 87/110 (79.09%), Query Frame = 1
BLAST of MELO3C008196 vs. TAIR10
Match: AT5G33280.1 (AT5G33280.1 Voltage-gated chloride channel family protein) HSP 1 Score: 92.4 bits (228), Expect = 1.9e-19 Identity = 46/92 (50.00%), Postives = 64/92 (69.57%), Query Frame = 1
BLAST of MELO3C008196 vs. TAIR10
Match: AT5G49890.1 (AT5G49890.1 chloride channel C) HSP 1 Score: 91.7 bits (226), Expect = 3.3e-19 Identity = 44/89 (49.44%), Postives = 62/89 (69.66%), Query Frame = 1
BLAST of MELO3C008196 vs. TAIR10
Match: AT5G26240.1 (AT5G26240.1 chloride channel D) HSP 1 Score: 65.5 bits (158), Expect = 2.5e-11 Identity = 33/72 (45.83%), Postives = 45/72 (62.50%), Query Frame = 1
BLAST of MELO3C008196 vs. NCBI nr
Match: gi|659082036|ref|XP_008441632.1| (PREDICTED: chloride channel protein CLC-b-like [Cucumis melo]) HSP 1 Score: 216.5 bits (550), Expect = 2.5e-53 Identity = 110/113 (97.35%), Postives = 110/113 (97.35%), Query Frame = 1
BLAST of MELO3C008196 vs. NCBI nr
Match: gi|659081469|ref|XP_008441347.1| (PREDICTED: chloride channel protein CLC-b-like [Cucumis melo]) HSP 1 Score: 194.5 bits (493), Expect = 1.0e-46 Identity = 101/113 (89.38%), Postives = 102/113 (90.27%), Query Frame = 1
BLAST of MELO3C008196 vs. NCBI nr
Match: gi|525507272|ref|NP_001267676.1| (chloride channel protein CLC-b-like [Cucumis sativus]) HSP 1 Score: 189.9 bits (481), Expect = 2.5e-45 Identity = 98/113 (86.73%), Postives = 101/113 (89.38%), Query Frame = 1
BLAST of MELO3C008196 vs. NCBI nr
Match: gi|641823955|gb|KDO43321.1| (hypothetical protein CISIN_1g0039662mg [Citrus sinensis]) HSP 1 Score: 177.2 bits (448), Expect = 1.7e-41 Identity = 87/112 (77.68%), Postives = 99/112 (88.39%), Query Frame = 1
BLAST of MELO3C008196 vs. NCBI nr
Match: gi|641823951|gb|KDO43317.1| (hypothetical protein CISIN_1g0039662mg, partial [Citrus sinensis]) HSP 1 Score: 177.2 bits (448), Expect = 1.7e-41 Identity = 87/112 (77.68%), Postives = 99/112 (88.39%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|