MELO3C008164 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.CAAAAGTAGAGTTCCAAATTCAAACCAACATTACAATTTACAGATCTCTCTCTTTTTCATCATCTCACTATGAAATCAGACTCCTCCAGTTCCCCATGGAACAACTTCCACACCACCATTTTCAGTTTCGACCACGACCGCCGCAACACAAAGGAACTACCAGCCTTAGCCTTAGTCTTGGAAGCCGGGGGAGGAGCAGGAGTTGGCTGCGGCCTTGGATTCGGCTTCGGACTCGTCGGAGGGATCGGCCACGGCGGTGCCTCGCCCTGGAATCACCTTCACCTCGTATTTGGCCTGGGTGCCGGCTGCGGCGTTGGGTTAGGGCTTGGAATTGGGCAAGGCTTTGGATATGGCTTCTCCTTTGAATCTCTTGATTCTTATTTCTCTCATCTCAATTCTGATCCTAAACATAAGCAGCCTTCCCTCATTCAATTTTGAAATTTCCTTTTCTTACCCCTTACCTTGCCCTTTAATTTTATGTATTTTCTTCTCTTTTCACAATTTTTTGTATCTTTCAACATCTTTTTGGACTTCTTATTTCTCCATCTAATTTGTATGCACCAACTACACATTCATAT CAAAAGTAGAGTTCCAAATTCAAACCAACATTACAATTTACAGATCTCTCTCTTTTTCATCATCTCACTATGAAATCAGACTCCTCCAGTTCCCCATGGAACAACTTCCACACCACCATTTTCAGTTTCGACCACGACCGCCGCAACACAAAGGAACTACCAGCCTTAGCCTTAGTCTTGGAAGCCGGGGGAGGAGCAGGAGTTGGCTGCGGCCTTGGATTCGGCTTCGGACTCGTCGGAGGGATCGGCCACGGCGGTGCCTCGCCCTGGAATCACCTTCACCTCGTATTTGGCCTGGGTGCCGGCTGCGGCGTTGGGTTAGGGCTTGGAATTGGGCAAGGCTTTGGATATGGCTTCTCCTTTGAATCTCTTGATTCTTATTTCTCTCATCTCAATTCTGATCCTAAACATAAGCAGCCTTCCCTCATTCAATTTTGAAATTTCCTTTTCTTACCCCTTACCTTGCCCTTTAATTTTATGTATTTTCTTCTCTTTTCACAATTTTTTGTATCTTTCAACATCTTTTTGGACTTCTTATTTCTCCATCTAATTTGTATGCACCAACTACACATTCATAT ATGAAATCAGACTCCTCCAGTTCCCCATGGAACAACTTCCACACCACCATTTTCAGTTTCGACCACGACCGCCGCAACACAAAGGAACTACCAGCCTTAGCCTTAGTCTTGGAAGCCGGGGGAGGAGCAGGAGTTGGCTGCGGCCTTGGATTCGGCTTCGGACTCGTCGGAGGGATCGGCCACGGCGGTGCCTCGCCCTGGAATCACCTTCACCTCGTATTTGGCCTGGGTGCCGGCTGCGGCGTTGGGTTAGGGCTTGGAATTGGGCAAGGCTTTGGATATGGCTTCTCCTTTGAATCTCTTGATTCTTATTTCTCTCATCTCAATTCTGATCCTAAACATAAGCAGCCTTCCCTCATTCAATTTTGA MKSDSSSSPWNNFHTTIFSFDHDRRNTKELPALALVLEAGGGAGVGCGLGFGFGLVGGIGHGGASPWNHLHLVFGLGAGCGVGLGLGIGQGFGYGFSFESLDSYFSHLNSDPKHKQPSLIQF*
BLAST of MELO3C008164 vs. Swiss-Prot
Match: TGD5_ARATH (Protein TRIGALACTOSYLDIACYLGLYCEROL 5, chloroplastic OS=Arabidopsis thaliana GN=TGD5 PE=1 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 6.4e-07 Identity = 32/78 (41.03%), Postives = 39/78 (50.00%), Query Frame = 1
HSP 2 Score: 34.7 bits (78), Expect = 9.0e-01 Identity = 16/29 (55.17%), Postives = 17/29 (58.62%), Query Frame = 1
BLAST of MELO3C008164 vs. Swiss-Prot
Match: K2C3_RABIT (Keratin, type II cytoskeletal 3 OS=Oryctolagus cuniculus GN=KRT3 PE=2 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 9.3e-06 Identity = 29/56 (51.79%), Postives = 28/56 (50.00%), Query Frame = 1
HSP 2 Score: 42.7 bits (99), Expect = 3.3e-03 Identity = 28/58 (48.28%), Postives = 28/58 (48.28%), Query Frame = 1
HSP 3 Score: 37.7 bits (86), Expect = 1.1e-01 Identity = 24/54 (44.44%), Postives = 22/54 (40.74%), Query Frame = 1
HSP 4 Score: 36.6 bits (83), Expect = 2.4e-01 Identity = 23/57 (40.35%), Postives = 24/57 (42.11%), Query Frame = 1
BLAST of MELO3C008164 vs. TrEMBL
Match: D2V5B6_NAEGR (Predicted protein OS=Naegleria gruberi GN=NAEGRDRAFT_64082 PE=4 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 4.5e-07 Identity = 35/67 (52.24%), Postives = 41/67 (61.19%), Query Frame = 1
BLAST of MELO3C008164 vs. TrEMBL
Match: D2V5B6_NAEGR (Predicted protein OS=Naegleria gruberi GN=NAEGRDRAFT_64082 PE=4 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 7.1e-05 Identity = 34/69 (49.28%), Postives = 38/69 (55.07%), Query Frame = 1
HSP 2 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 3 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 4 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 5 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 6 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 7 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 8 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 9 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 10 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 11 Score: 53.9 bits (128), Expect = 1.6e-04 Identity = 32/63 (50.79%), Postives = 36/63 (57.14%), Query Frame = 1
HSP 12 Score: 48.9 bits (115), Expect = 5.1e-03 Identity = 28/59 (47.46%), Postives = 33/59 (55.93%), Query Frame = 1
HSP 13 Score: 59.7 bits (143), Expect = 2.9e-06 Identity = 38/79 (48.10%), Postives = 44/79 (55.70%), Query Frame = 1
BLAST of MELO3C008164 vs. TrEMBL
Match: A0A158PUT0_BRUMA (Uncharacterized protein OS=Brugia malayi PE=4 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 2.5e-05 Identity = 34/65 (52.31%), Postives = 38/65 (58.46%), Query Frame = 1
HSP 2 Score: 56.6 bits (135), Expect = 2.5e-05 Identity = 34/67 (50.75%), Postives = 38/67 (56.72%), Query Frame = 1
HSP 3 Score: 56.6 bits (135), Expect = 2.5e-05 Identity = 34/64 (53.12%), Postives = 38/64 (59.38%), Query Frame = 1
HSP 4 Score: 56.6 bits (135), Expect = 2.5e-05 Identity = 34/64 (53.12%), Postives = 38/64 (59.38%), Query Frame = 1
HSP 5 Score: 56.6 bits (135), Expect = 2.5e-05 Identity = 34/64 (53.12%), Postives = 38/64 (59.38%), Query Frame = 1
HSP 6 Score: 56.6 bits (135), Expect = 2.5e-05 Identity = 34/67 (50.75%), Postives = 38/67 (56.72%), Query Frame = 1
HSP 7 Score: 56.6 bits (135), Expect = 2.5e-05 Identity = 34/65 (52.31%), Postives = 38/65 (58.46%), Query Frame = 1
HSP 8 Score: 56.6 bits (135), Expect = 2.5e-05 Identity = 34/64 (53.12%), Postives = 38/64 (59.38%), Query Frame = 1
HSP 9 Score: 56.6 bits (135), Expect = 2.5e-05 Identity = 34/64 (53.12%), Postives = 38/64 (59.38%), Query Frame = 1
HSP 10 Score: 55.8 bits (133), Expect = 4.2e-05 Identity = 38/89 (42.70%), Postives = 44/89 (49.44%), Query Frame = 1
HSP 11 Score: 55.1 bits (131), Expect = 7.1e-05 Identity = 32/65 (49.23%), Postives = 37/65 (56.92%), Query Frame = 1
HSP 12 Score: 54.7 bits (130), Expect = 9.3e-05 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 13 Score: 54.7 bits (130), Expect = 9.3e-05 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 14 Score: 54.7 bits (130), Expect = 9.3e-05 Identity = 32/63 (50.79%), Postives = 36/63 (57.14%), Query Frame = 1
HSP 15 Score: 54.7 bits (130), Expect = 9.3e-05 Identity = 32/63 (50.79%), Postives = 36/63 (57.14%), Query Frame = 1
HSP 16 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 17 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 18 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 19 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 20 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 21 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 22 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 23 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 24 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 25 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 26 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 27 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 28 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 29 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 30 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 31 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 32 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 33 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 34 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 35 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 36 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 37 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 38 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 39 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 40 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 41 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 42 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 43 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 44 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 45 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 46 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 47 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 48 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 49 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 50 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 51 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 52 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 53 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 54 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 55 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 56 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 57 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 58 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 59 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 60 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 61 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 62 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 63 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 64 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 65 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 66 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 67 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 68 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 69 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 70 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 71 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 72 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 73 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 74 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 75 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 76 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 77 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 78 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 79 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 80 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 81 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 82 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 83 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 84 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 85 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 86 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 87 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 88 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 89 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 90 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 34/70 (48.57%), Postives = 38/70 (54.29%), Query Frame = 1
HSP 91 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 92 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 93 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 94 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 95 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 96 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 97 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 98 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 99 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 100 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 101 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 102 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 103 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 104 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 105 Score: 59.3 bits (142), Expect = 3.8e-06 Identity = 34/64 (53.12%), Postives = 38/64 (59.38%), Query Frame = 1
BLAST of MELO3C008164 vs. TrEMBL
Match: F0YQ73_AURAN (Putative uncharacterized protein (Fragment) OS=Aureococcus anophagefferens GN=AURANDRAFT_68611 PE=4 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 2 Score: 54.3 bits (129), Expect = 1.2e-04 Identity = 33/64 (51.56%), Postives = 37/64 (57.81%), Query Frame = 1
HSP 3 Score: 53.9 bits (128), Expect = 1.6e-04 Identity = 32/63 (50.79%), Postives = 36/63 (57.14%), Query Frame = 1
HSP 4 Score: 53.9 bits (128), Expect = 1.6e-04 Identity = 32/63 (50.79%), Postives = 36/63 (57.14%), Query Frame = 1
HSP 5 Score: 52.8 bits (125), Expect = 3.5e-04 Identity = 33/68 (48.53%), Postives = 37/68 (54.41%), Query Frame = 1
HSP 6 Score: 51.2 bits (121), Expect = 1.0e-03 Identity = 32/64 (50.00%), Postives = 36/64 (56.25%), Query Frame = 1
HSP 7 Score: 51.2 bits (121), Expect = 1.0e-03 Identity = 32/64 (50.00%), Postives = 36/64 (56.25%), Query Frame = 1
HSP 8 Score: 51.2 bits (121), Expect = 1.0e-03 Identity = 32/64 (50.00%), Postives = 36/64 (56.25%), Query Frame = 1
HSP 9 Score: 58.5 bits (140), Expect = 6.5e-06 Identity = 33/61 (54.10%), Postives = 35/61 (57.38%), Query Frame = 1
BLAST of MELO3C008164 vs. TrEMBL
Match: I3MYH6_ICTTR (Uncharacterized protein OS=Ictidomys tridecemlineatus GN=KRT3 PE=3 SV=1) HSP 1 Score: 48.9 bits (115), Expect = 5.1e-03 Identity = 31/63 (49.21%), Postives = 33/63 (52.38%), Query Frame = 1
HSP 2 Score: 45.1 bits (105), Expect = 7.4e-02 Identity = 29/62 (46.77%), Postives = 31/62 (50.00%), Query Frame = 1
HSP 3 Score: 37.4 bits (85), Expect = 1.5e+01 Identity = 26/58 (44.83%), Postives = 31/58 (53.45%), Query Frame = 1
HSP 4 Score: 37.0 bits (84), Expect = 2.0e+01 Identity = 27/56 (48.21%), Postives = 27/56 (48.21%), Query Frame = 1
HSP 5 Score: 58.2 bits (139), Expect = 8.4e-06 Identity = 38/83 (45.78%), Postives = 45/83 (54.22%), Query Frame = 1
BLAST of MELO3C008164 vs. TAIR10
Match: AT1G66820.1 (AT1G66820.1 glycine-rich protein) HSP 1 Score: 73.6 bits (179), Expect = 9.8e-14 Identity = 31/66 (46.97%), Postives = 39/66 (59.09%), Query Frame = 1
BLAST of MELO3C008164 vs. TAIR10
Match: AT4G10330.1 (AT4G10330.1 glycine-rich protein) HSP 1 Score: 68.2 bits (165), Expect = 4.1e-12 Identity = 32/65 (49.23%), Postives = 39/65 (60.00%), Query Frame = 1
BLAST of MELO3C008164 vs. TAIR10
Match: AT1G27695.1 (AT1G27695.1 glycine-rich protein) HSP 1 Score: 55.1 bits (131), Expect = 3.6e-08 Identity = 32/78 (41.03%), Postives = 39/78 (50.00%), Query Frame = 1
HSP 2 Score: 34.7 bits (78), Expect = 5.1e-02 Identity = 16/29 (55.17%), Postives = 17/29 (58.62%), Query Frame = 1
BLAST of MELO3C008164 vs. TAIR10
Match: AT3G23450.1 (AT3G23450.1 unknown protein) HSP 1 Score: 48.5 bits (114), Expect = 3.4e-06 Identity = 26/57 (45.61%), Postives = 31/57 (54.39%), Query Frame = 1
HSP 2 Score: 48.1 bits (113), Expect = 4.4e-06 Identity = 26/56 (46.43%), Postives = 29/56 (51.79%), Query Frame = 1
HSP 3 Score: 47.8 bits (112), Expect = 5.8e-06 Identity = 27/57 (47.37%), Postives = 30/57 (52.63%), Query Frame = 1
HSP 4 Score: 47.8 bits (112), Expect = 5.8e-06 Identity = 26/59 (44.07%), Postives = 31/59 (52.54%), Query Frame = 1
HSP 5 Score: 47.4 bits (111), Expect = 7.5e-06 Identity = 27/59 (45.76%), Postives = 29/59 (49.15%), Query Frame = 1
HSP 6 Score: 47.0 bits (110), Expect = 9.8e-06 Identity = 26/56 (46.43%), Postives = 30/56 (53.57%), Query Frame = 1
HSP 7 Score: 47.0 bits (110), Expect = 9.8e-06 Identity = 26/56 (46.43%), Postives = 30/56 (53.57%), Query Frame = 1
HSP 8 Score: 47.0 bits (110), Expect = 9.8e-06 Identity = 26/56 (46.43%), Postives = 28/56 (50.00%), Query Frame = 1
HSP 9 Score: 46.6 bits (109), Expect = 1.3e-05 Identity = 26/56 (46.43%), Postives = 30/56 (53.57%), Query Frame = 1
HSP 10 Score: 46.6 bits (109), Expect = 1.3e-05 Identity = 25/56 (44.64%), Postives = 30/56 (53.57%), Query Frame = 1
HSP 11 Score: 46.6 bits (109), Expect = 1.3e-05 Identity = 25/56 (44.64%), Postives = 30/56 (53.57%), Query Frame = 1
HSP 12 Score: 46.6 bits (109), Expect = 1.3e-05 Identity = 25/56 (44.64%), Postives = 30/56 (53.57%), Query Frame = 1
HSP 13 Score: 46.6 bits (109), Expect = 1.3e-05 Identity = 26/56 (46.43%), Postives = 30/56 (53.57%), Query Frame = 1
HSP 14 Score: 46.2 bits (108), Expect = 1.7e-05 Identity = 25/56 (44.64%), Postives = 30/56 (53.57%), Query Frame = 1
HSP 15 Score: 45.8 bits (107), Expect = 2.2e-05 Identity = 26/56 (46.43%), Postives = 29/56 (51.79%), Query Frame = 1
HSP 16 Score: 45.4 bits (106), Expect = 2.9e-05 Identity = 27/56 (48.21%), Postives = 28/56 (50.00%), Query Frame = 1
HSP 17 Score: 45.1 bits (105), Expect = 3.7e-05 Identity = 27/56 (48.21%), Postives = 28/56 (50.00%), Query Frame = 1
HSP 18 Score: 42.0 bits (97), Expect = 3.2e-04 Identity = 26/56 (46.43%), Postives = 28/56 (50.00%), Query Frame = 1
BLAST of MELO3C008164 vs. TAIR10
Match: AT2G32690.1 (AT2G32690.1 glycine-rich protein 23) HSP 1 Score: 48.1 bits (113), Expect = 4.4e-06 Identity = 30/59 (50.85%), Postives = 30/59 (50.85%), Query Frame = 1
HSP 2 Score: 47.8 bits (112), Expect = 5.8e-06 Identity = 31/59 (52.54%), Postives = 29/59 (49.15%), Query Frame = 1
HSP 3 Score: 47.0 bits (110), Expect = 9.8e-06 Identity = 29/59 (49.15%), Postives = 29/59 (49.15%), Query Frame = 1
HSP 4 Score: 46.6 bits (109), Expect = 1.3e-05 Identity = 29/59 (49.15%), Postives = 29/59 (49.15%), Query Frame = 1
HSP 5 Score: 46.6 bits (109), Expect = 1.3e-05 Identity = 29/59 (49.15%), Postives = 29/59 (49.15%), Query Frame = 1
HSP 6 Score: 44.7 bits (104), Expect = 4.9e-05 Identity = 30/62 (48.39%), Postives = 31/62 (50.00%), Query Frame = 1
HSP 7 Score: 44.7 bits (104), Expect = 4.9e-05 Identity = 27/60 (45.00%), Postives = 27/60 (45.00%), Query Frame = 1
HSP 8 Score: 31.6 bits (70), Expect = 4.3e-01 Identity = 15/24 (62.50%), Postives = 14/24 (58.33%), Query Frame = 1
BLAST of MELO3C008164 vs. NCBI nr
Match: gi|700208027|gb|KGN63146.1| (hypothetical protein Csa_2G404970 [Cucumis sativus]) HSP 1 Score: 219.2 bits (557), Expect = 4.1e-54 Identity = 107/122 (87.70%), Postives = 111/122 (90.98%), Query Frame = 1
BLAST of MELO3C008164 vs. NCBI nr
Match: gi|590652501|ref|XP_007033168.1| (Uncharacterized protein TCM_019361 [Theobroma cacao]) HSP 1 Score: 117.1 bits (292), Expect = 2.2e-23 Identity = 53/69 (76.81%), Postives = 58/69 (84.06%), Query Frame = 1
BLAST of MELO3C008164 vs. NCBI nr
Match: gi|1009126208|ref|XP_015880027.1| (PREDICTED: fibroin heavy chain [Ziziphus jujuba]) HSP 1 Score: 110.9 bits (276), Expect = 1.6e-21 Identity = 53/76 (69.74%), Postives = 57/76 (75.00%), Query Frame = 1
BLAST of MELO3C008164 vs. NCBI nr
Match: gi|657979086|ref|XP_008381491.1| (PREDICTED: keratin, type II cytoskeletal 3 [Malus domestica]) HSP 1 Score: 110.2 bits (274), Expect = 2.7e-21 Identity = 48/67 (71.64%), Postives = 54/67 (80.60%), Query Frame = 1
BLAST of MELO3C008164 vs. NCBI nr
Match: gi|645246272|ref|XP_008229276.1| (PREDICTED: fibroin heavy chain [Prunus mume]) HSP 1 Score: 103.2 bits (256), Expect = 3.3e-19 Identity = 48/79 (60.76%), Postives = 60/79 (75.95%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|