MELO3C007910.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGAGATGCATTCACATTGGACTATTGTGTGTTCAAGAAAATGCAGTAGATCGACCGACAATGGCTTCGGTGGTTTTGATGCTGAGTAGTTTCTCTCTCACTCTCTCCGTGCCCTCCGACCCGGCATTCTTTATGCACAGTAATATTGAAGAATCTAACAGTGTGGTAAAACCAAATGGTGGTCATATGAAAAGCACATCTCTTGAGCCATCACTCAATGAAGTTTCAATTACTGAGCTCCGACCTCGCTAG ATGATGAGATGCATTCACATTGGACTATTGTGTGTTCAAGAAAATGCAGTAGATCGACCGACAATGGCTTCGGTGGTTTTGATGCTGAGTAGTTTCTCTCTCACTCTCTCCGTGCCCTCCGACCCGGCATTCTTTATGCACAGTAATATTGAAGAATCTAACAGTGTGGTAAAACCAAATGGTGGTCATATGAAAAGCACATCTCTTGAGCCATCACTCAATGAAGTTTCAATTACTGAGCTCCGACCTCGCTAG ATGATGAGATGCATTCACATTGGACTATTGTGTGTTCAAGAAAATGCAGTAGATCGACCGACAATGGCTTCGGTGGTTTTGATGCTGAGTAGTTTCTCTCTCACTCTCTCCGTGCCCTCCGACCCGGCATTCTTTATGCACAGTAATATTGAAGAATCTAACAGTGTGGTAAAACCAAATGGTGGTCATATGAAAAGCACATCTCTTGAGCCATCACTCAATGAAGTTTCAATTACTGAGCTCCGACCTCGCTAG MMRCIHIGLLCVQENAVDRPTMASVVLMLSSFSLTLSVPSDPAFFMHSNIEESNSVVKPNGGHMKSTSLEPSLNEVSITELRPR
BLAST of MELO3C007910.2 vs. NCBI nr
Match: XP_004135028.1 (PREDICTED: cysteine-rich receptor-like protein kinase 26 [Cucumis sativus]) HSP 1 Score: 148.3 bits (373), Expect = 1.2e-32 Identity = 75/84 (89.29%), Postives = 80/84 (95.24%), Query Frame = 0
BLAST of MELO3C007910.2 vs. NCBI nr
Match: XP_022142134.1 (cysteine-rich receptor-like protein kinase 10 isoform X1 [Momordica charantia]) HSP 1 Score: 112.1 bits (279), Expect = 9.4e-22 Identity = 59/91 (64.84%), Postives = 71/91 (78.02%), Query Frame = 0
BLAST of MELO3C007910.2 vs. NCBI nr
Match: XP_022142135.1 (putative receptor-like protein kinase At4g00960 isoform X2 [Momordica charantia]) HSP 1 Score: 112.1 bits (279), Expect = 9.4e-22 Identity = 59/91 (64.84%), Postives = 71/91 (78.02%), Query Frame = 0
BLAST of MELO3C007910.2 vs. NCBI nr
Match: XP_022926744.1 (cysteine-rich receptor-like protein kinase 29 isoform X2 [Cucurbita moschata]) HSP 1 Score: 109.0 bits (271), Expect = 7.9e-21 Identity = 55/85 (64.71%), Postives = 69/85 (81.18%), Query Frame = 0
BLAST of MELO3C007910.2 vs. NCBI nr
Match: XP_022926743.1 (cysteine-rich receptor-like protein kinase 29 isoform X1 [Cucurbita moschata]) HSP 1 Score: 109.0 bits (271), Expect = 7.9e-21 Identity = 55/85 (64.71%), Postives = 69/85 (81.18%), Query Frame = 0
BLAST of MELO3C007910.2 vs. TAIR10
Match: AT4G21410.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 29) HSP 1 Score: 74.3 bits (181), Expect = 3.9e-14 Identity = 41/84 (48.81%), Postives = 55/84 (65.48%), Query Frame = 0
BLAST of MELO3C007910.2 vs. TAIR10
Match: AT4G21400.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 28) HSP 1 Score: 73.9 bits (180), Expect = 5.1e-14 Identity = 44/87 (50.57%), Postives = 56/87 (64.37%), Query Frame = 0
BLAST of MELO3C007910.2 vs. TAIR10
Match: AT4G38830.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 26) HSP 1 Score: 73.9 bits (180), Expect = 5.1e-14 Identity = 46/85 (54.12%), Postives = 56/85 (65.88%), Query Frame = 0
BLAST of MELO3C007910.2 vs. TAIR10
Match: AT4G23290.2 (cysteine-rich RLK (RECEPTOR-like protein kinase) 21) HSP 1 Score: 72.0 bits (175), Expect = 2.0e-13 Identity = 38/84 (45.24%), Postives = 53/84 (63.10%), Query Frame = 0
BLAST of MELO3C007910.2 vs. TAIR10
Match: AT4G00970.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 41) HSP 1 Score: 71.2 bits (173), Expect = 3.3e-13 Identity = 46/84 (54.76%), Postives = 55/84 (65.48%), Query Frame = 0
BLAST of MELO3C007910.2 vs. Swiss-Prot
Match: sp|Q8S9L6|CRK29_ARATH (Cysteine-rich receptor-like protein kinase 29 OS=Arabidopsis thaliana OX=3702 GN=CRK29 PE=2 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 7.1e-13 Identity = 41/84 (48.81%), Postives = 55/84 (65.48%), Query Frame = 0
BLAST of MELO3C007910.2 vs. Swiss-Prot
Match: sp|Q9T0J1|CRK26_ARATH (Cysteine-rich receptor-like protein kinase 26 OS=Arabidopsis thaliana OX=3702 GN=CRK26 PE=2 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 9.3e-13 Identity = 46/85 (54.12%), Postives = 56/85 (65.88%), Query Frame = 0
BLAST of MELO3C007910.2 vs. Swiss-Prot
Match: sp|O65405|CRK28_ARATH (Cysteine-rich receptor-like protein kinase 28 OS=Arabidopsis thaliana OX=3702 GN=CRK28 PE=3 SV=2) HSP 1 Score: 73.9 bits (180), Expect = 9.3e-13 Identity = 44/87 (50.57%), Postives = 56/87 (64.37%), Query Frame = 0
BLAST of MELO3C007910.2 vs. Swiss-Prot
Match: sp|Q3E9X6|CRK21_ARATH (Cysteine-rich receptor-like protein kinase 21 OS=Arabidopsis thaliana OX=3702 GN=CRK21 PE=2 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 3.5e-12 Identity = 38/84 (45.24%), Postives = 53/84 (63.10%), Query Frame = 0
BLAST of MELO3C007910.2 vs. Swiss-Prot
Match: sp|O23081|CRK41_ARATH (Cysteine-rich receptor-like protein kinase 41 OS=Arabidopsis thaliana OX=3702 GN=CRK41 PE=3 SV=2) HSP 1 Score: 71.2 bits (173), Expect = 6.0e-12 Identity = 46/84 (54.76%), Postives = 55/84 (65.48%), Query Frame = 0
BLAST of MELO3C007910.2 vs. TrEMBL
Match: tr|A0A0A0KMG4|A0A0A0KMG4_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G505980 PE=4 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 9.9e-20 Identity = 54/63 (85.71%), Postives = 59/63 (93.65%), Query Frame = 0
BLAST of MELO3C007910.2 vs. TrEMBL
Match: tr|A0A2N9EM35|A0A2N9EM35_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS3501 PE=4 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 2.9e-19 Identity = 54/90 (60.00%), Postives = 66/90 (73.33%), Query Frame = 0
BLAST of MELO3C007910.2 vs. TrEMBL
Match: tr|A0A2P4GRM6|A0A2P4GRM6_QUESU (Cysteine-rich receptor-like protein kinase 28 OS=Quercus suber OX=58331 GN=CFP56_61822 PE=4 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 6.4e-19 Identity = 58/91 (63.74%), Postives = 68/91 (74.73%), Query Frame = 0
BLAST of MELO3C007910.2 vs. TrEMBL
Match: tr|A0A2P4JS93|A0A2P4JS93_QUESU (Cysteine-rich receptor-like protein kinase 29 OS=Quercus suber OX=58331 GN=CFP56_06730 PE=4 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 1.1e-18 Identity = 58/91 (63.74%), Postives = 68/91 (74.73%), Query Frame = 0
BLAST of MELO3C007910.2 vs. TrEMBL
Match: tr|A0A2R6P1X8|A0A2R6P1X8_ACTCH (Cysteine-rich receptor-like protein kinase OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc33613 PE=3 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 2.4e-18 Identity = 53/90 (58.89%), Postives = 67/90 (74.44%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |