MELO3C007910 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTCGGTGGTTTTGATGCTGAGTAGTTTCTCTCTCACTCTCTCCGTGCCCTCCGACCCGGCATTCTTTATGCACAGTAATATTGAAGAATCTAACAGTGTGGTAAAACCAAATGGTGGTCATATGAAAAGCACATCTCTTGAGCCATCACTCAATGAAGTTTCAATTACTGAGCTCCGACCTCGCTAG ATGGCTTCGGTGGTTTTGATGCTGAGTAGTTTCTCTCTCACTCTCTCCGTGCCCTCCGACCCGGCATTCTTTATGCACAGTAATATTGAAGAATCTAACAGTGTGGTAAAACCAAATGGTGGTCATATGAAAAGCACATCTCTTGAGCCATCACTCAATGAAGTTTCAATTACTGAGCTCCGACCTCGCTAG ATGGCTTCGGTGGTTTTGATGCTGAGTAGTTTCTCTCTCACTCTCTCCGTGCCCTCCGACCCGGCATTCTTTATGCACAGTAATATTGAAGAATCTAACAGTGTGGTAAAACCAAATGGTGGTCATATGAAAAGCACATCTCTTGAGCCATCACTCAATGAAGTTTCAATTACTGAGCTCCGACCTCGCTAG MASVVLMLSSFSLTLSVPSDPAFFMHSNIEESNSVVKPNGGHMKSTSLEPSLNEVSITELRPR*
BLAST of MELO3C007910 vs. TrEMBL
Match: A0A0A0KMG4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G505980 PE=4 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 3.7e-21 Identity = 54/63 (85.71%), Postives = 59/63 (93.65%), Query Frame = 1
BLAST of MELO3C007910 vs. TrEMBL
Match: Q8VX50_SOLTU (Putative receptor-like serine-threonine protein kinase OS=Solanum tuberosum GN=prk-4 PE=2 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 5.5e-09 Identity = 39/70 (55.71%), Postives = 48/70 (68.57%), Query Frame = 1
BLAST of MELO3C007910 vs. TrEMBL
Match: A0A0D2RZ61_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G084500 PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 9.4e-09 Identity = 37/64 (57.81%), Postives = 44/64 (68.75%), Query Frame = 1
BLAST of MELO3C007910 vs. TrEMBL
Match: A0A0D2NNQ4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G084500 PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 9.4e-09 Identity = 37/64 (57.81%), Postives = 44/64 (68.75%), Query Frame = 1
BLAST of MELO3C007910 vs. TrEMBL
Match: Q8VX51_SOLTU (Putative receptor-like serine-threonine protein kinase OS=Solanum tuberosum GN=prk-3 PE=2 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 9.4e-09 Identity = 39/70 (55.71%), Postives = 47/70 (67.14%), Query Frame = 1
BLAST of MELO3C007910 vs. TAIR10
Match: AT4G38830.1 (AT4G38830.1 cysteine-rich RLK (RECEPTOR-like protein kinase) 26) HSP 1 Score: 46.2 bits (108), Expect = 8.7e-06 Identity = 32/64 (50.00%), Postives = 37/64 (57.81%), Query Frame = 1
BLAST of MELO3C007910 vs. NCBI nr
Match: gi|700193717|gb|KGN48921.1| (hypothetical protein Csa_6G505980 [Cucumis sativus]) HSP 1 Score: 108.2 bits (269), Expect = 5.3e-21 Identity = 54/63 (85.71%), Postives = 59/63 (93.65%), Query Frame = 1
BLAST of MELO3C007910 vs. NCBI nr
Match: gi|449434488|ref|XP_004135028.1| (PREDICTED: cysteine-rich receptor-like protein kinase 26 [Cucumis sativus]) HSP 1 Score: 108.2 bits (269), Expect = 5.3e-21 Identity = 54/63 (85.71%), Postives = 59/63 (93.65%), Query Frame = 1
BLAST of MELO3C007910 vs. NCBI nr
Match: gi|18076589|emb|CAC83607.1| (putative receptor-like serine-threonine protein kinase [Solanum tuberosum]) HSP 1 Score: 67.8 bits (164), Expect = 7.9e-09 Identity = 39/70 (55.71%), Postives = 48/70 (68.57%), Query Frame = 1
BLAST of MELO3C007910 vs. NCBI nr
Match: gi|18076587|emb|CAC84518.1| (putative receptor-like serine-threonine protein kinase [Solanum tuberosum]) HSP 1 Score: 67.0 bits (162), Expect = 1.4e-08 Identity = 39/70 (55.71%), Postives = 47/70 (67.14%), Query Frame = 1
BLAST of MELO3C007910 vs. NCBI nr
Match: gi|823171042|ref|XP_012484670.1| (PREDICTED: putative receptor-like protein kinase At4g00960 isoform X1 [Gossypium raimondii]) HSP 1 Score: 67.0 bits (162), Expect = 1.4e-08 Identity = 37/64 (57.81%), Postives = 44/64 (68.75%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |