MELO3C007030.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: five_prime_UTRexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTGGCTTTAAGGGGACTGAACTCGGGCATGAAGAAGCAAGACGTGGTTGCCCTCCCAACTTCAACTTACACGAACTCTGGATCACCGACTTCGCCTTCGCCTTCATCCACTTCAGCCTGTGCTATCTGCCTCATCGACTTCTCAAATGGGGATACAATACGAGTGTTGCCGAACTGTGCTCATAGGTACCATGTCAGTTGCATTGATAAATGGTTGCTGTCTCACTCTTCTTGCCCCACCTGCAGGCATCAGCTCAAGTCCAAGGATTCTATAGAACACATTGTGTAG ATGGGTGGCTTTAAGGGGACTGAACTCGGGCATGAAGAAGCAAGACGTGGTTGCCCTCCCAACTTCAACTTACACGAACTCTGGATCACCGACTTCGCCTTCGCCTTCATCCACTTCAGCCTGTGCTATCTGCCTCATCGACTTCTCAAATGGGGATACAATACGAGTGTTGCCGAACTGTGCTCATAGGTACCATGTCAGTTGCATTGATAAATGGTTGCTGTCTCACTCTTCTTGCCCCACCTGCAGGCATCAGCTCAAGTCCAAGGATTCTATAGAACACATTGTGTAG ATGAAGAAGCAAGACGTGGTTGCCCTCCCAACTTCAACTTACACGAACTCTGGATCACCGACTTCGCCTTCGCCTTCATCCACTTCAGCCTGTGCTATCTGCCTCATCGACTTCTCAAATGGGGATACAATACGAGTGTTGCCGAACTGTGCTCATAGGTACCATGTCAGTTGCATTGATAAATGGTTGCTGTCTCACTCTTCTTGCCCCACCTGCAGGCATCAGCTCAAGTCCAAGGATTCTATAGAACACATTGTGTAG MKKQDVVALPTSTYTNSGSPTSPSPSSTSACAICLIDFSNGDTIRVLPNCAHRYHVSCIDKWLLSHSSCPTCRHQLKSKDSIEHIV
BLAST of MELO3C007030.2 vs. NCBI nr
Match: ADN34219.1 (ring zinc finger [Cucumis melo subsp. melo]) HSP 1 Score: 154.8 bits (390), Expect = 1.3e-34 Identity = 86/86 (100.00%), Postives = 86/86 (100.00%), Query Frame = 0
BLAST of MELO3C007030.2 vs. NCBI nr
Match: XP_008439485.1 (PREDICTED: RING-H2 finger protein ATL74-like [Cucumis melo]) HSP 1 Score: 154.8 bits (390), Expect = 1.3e-34 Identity = 86/86 (100.00%), Postives = 86/86 (100.00%), Query Frame = 0
BLAST of MELO3C007030.2 vs. NCBI nr
Match: XP_004134885.2 (PREDICTED: RING-H2 finger protein ATL74-like [Cucumis sativus] >KGN49508.1 hypothetical protein Csa_6G526420 [Cucumis sativus]) HSP 1 Score: 145.6 bits (366), Expect = 7.8e-32 Identity = 69/86 (80.23%), Postives = 72/86 (83.72%), Query Frame = 0
BLAST of MELO3C007030.2 vs. NCBI nr
Match: XP_022146710.1 (RING-H2 finger protein ATL74-like [Momordica charantia]) HSP 1 Score: 127.5 bits (319), Expect = 2.2e-26 Identity = 60/85 (70.59%), Postives = 64/85 (75.29%), Query Frame = 0
BLAST of MELO3C007030.2 vs. NCBI nr
Match: XP_022977991.1 (RING-H2 finger protein ATL74-like [Cucurbita maxima]) HSP 1 Score: 126.3 bits (316), Expect = 4.9e-26 Identity = 61/90 (67.78%), Postives = 68/90 (75.56%), Query Frame = 0
BLAST of MELO3C007030.2 vs. TAIR10
Match: AT2G17450.1 (RING-H2 finger A3A) HSP 1 Score: 79.7 bits (195), Expect = 9.6e-16 Identity = 38/78 (48.72%), Postives = 49/78 (62.82%), Query Frame = 0
BLAST of MELO3C007030.2 vs. TAIR10
Match: AT4G35480.1 (RING-H2 finger A3B) HSP 1 Score: 77.4 bits (189), Expect = 4.8e-15 Identity = 38/86 (44.19%), Postives = 49/86 (56.98%), Query Frame = 0
BLAST of MELO3C007030.2 vs. TAIR10
Match: AT5G05280.1 (RING/U-box superfamily protein) HSP 1 Score: 75.9 bits (185), Expect = 1.4e-14 Identity = 31/44 (70.45%), Postives = 34/44 (77.27%), Query Frame = 0
BLAST of MELO3C007030.2 vs. TAIR10
Match: AT5G01880.1 (RING/U-box superfamily protein) HSP 1 Score: 74.7 bits (182), Expect = 3.1e-14 Identity = 34/76 (44.74%), Postives = 47/76 (61.84%), Query Frame = 0
BLAST of MELO3C007030.2 vs. TAIR10
Match: AT1G76410.1 (RING/U-box superfamily protein) HSP 1 Score: 73.6 bits (179), Expect = 6.9e-14 Identity = 36/76 (47.37%), Postives = 45/76 (59.21%), Query Frame = 0
BLAST of MELO3C007030.2 vs. Swiss-Prot
Match: sp|O22755|ATL44_ARATH (Probable E3 ubiquitin-protein ligase ATL44 OS=Arabidopsis thaliana OX=3702 GN=ATL44 PE=2 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.7e-14 Identity = 38/78 (48.72%), Postives = 49/78 (62.82%), Query Frame = 0
BLAST of MELO3C007030.2 vs. Swiss-Prot
Match: sp|Q9ZT49|ATL45_ARATH (Probable E3 ubiquitin-protein ligase ATL45 OS=Arabidopsis thaliana OX=3702 GN=ATL45 PE=2 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 8.6e-14 Identity = 38/86 (44.19%), Postives = 49/86 (56.98%), Query Frame = 0
BLAST of MELO3C007030.2 vs. Swiss-Prot
Match: sp|Q9FLC6|ATL73_ARATH (RING-H2 finger protein ATL73 OS=Arabidopsis thaliana OX=3702 GN=ATL73 PE=2 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 2.5e-13 Identity = 31/44 (70.45%), Postives = 34/44 (77.27%), Query Frame = 0
BLAST of MELO3C007030.2 vs. Swiss-Prot
Match: sp|Q9LZV8|ATL74_ARATH (RING-H2 finger protein ATL74 OS=Arabidopsis thaliana OX=3702 GN=ATL74 PE=2 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 5.6e-13 Identity = 34/76 (44.74%), Postives = 47/76 (61.84%), Query Frame = 0
BLAST of MELO3C007030.2 vs. Swiss-Prot
Match: sp|Q8LC69|ATL8_ARATH (RING-H2 finger protein ATL8 OS=Arabidopsis thaliana OX=3702 GN=ATL8 PE=2 SV=2) HSP 1 Score: 73.6 bits (179), Expect = 1.2e-12 Identity = 36/76 (47.37%), Postives = 45/76 (59.21%), Query Frame = 0
BLAST of MELO3C007030.2 vs. TrEMBL
Match: tr|A0A1S3AYW1|A0A1S3AYW1_CUCME (RING-H2 finger protein ATL74-like OS=Cucumis melo OX=3656 GN=LOC103484271 PE=4 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 8.5e-35 Identity = 86/86 (100.00%), Postives = 86/86 (100.00%), Query Frame = 0
BLAST of MELO3C007030.2 vs. TrEMBL
Match: tr|E5GCL9|E5GCL9_CUCME (Ring zinc finger OS=Cucumis melo subsp. melo OX=412675 PE=4 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 8.5e-35 Identity = 86/86 (100.00%), Postives = 86/86 (100.00%), Query Frame = 0
BLAST of MELO3C007030.2 vs. TrEMBL
Match: tr|A0A0A0KJ24|A0A0A0KJ24_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G526420 PE=4 SV=1) HSP 1 Score: 145.6 bits (366), Expect = 5.2e-32 Identity = 69/86 (80.23%), Postives = 72/86 (83.72%), Query Frame = 0
BLAST of MELO3C007030.2 vs. TrEMBL
Match: tr|A0A2I4GBE1|A0A2I4GBE1_9ROSI (RING-H2 finger protein ATL74-like OS=Juglans regia OX=51240 GN=LOC109006368 PE=4 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 2.3e-24 Identity = 53/85 (62.35%), Postives = 67/85 (78.82%), Query Frame = 0
BLAST of MELO3C007030.2 vs. TrEMBL
Match: tr|A0A061DVX2|A0A061DVX2_THECC (RING/U-box superfamily protein OS=Theobroma cacao OX=3641 GN=TCM_006010 PE=4 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 2.2e-22 Identity = 52/85 (61.18%), Postives = 63/85 (74.12%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|