MELO3C007017 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAAGAGGAAAAATCGCAATCAGGAGAATAGAGAATCGGACGACAAGGCAAGTTACATTCTCGAAGCGGAGAGGCGGTCTGTTCAAGAAGACCCATGAACTTTCTGTTTTATGTGATGCTCAGATCGCTCTCATCGTCTTCTCCAGCAACGGCAAATTGTTCGAATACTGTACTCAAACAACATGGTATTAA ATGGGAAGAGGAAAAATCGCAATCAGGAGAATAGAGAATCGGACGACAAGGCAAGTTACATTCTCGAAGCGGAGAGGCGGTCTGTTCAAGAAGACCCATGAACTTTCTGTTTTATGTGATGCTCAGATCGCTCTCATCGTCTTCTCCAGCAACGGCAAATTGTTCGAATACTGTACTCAAACAACATGGTATTAA ATGGGAAGAGGAAAAATCGCAATCAGGAGAATAGAGAATCGGACGACAAGGCAAGTTACATTCTCGAAGCGGAGAGGCGGTCTGTTCAAGAAGACCCATGAACTTTCTGTTTTATGTGATGCTCAGATCGCTCTCATCGTCTTCTCCAGCAACGGCAAATTGTTCGAATACTGTACTCAAACAACATGGTATTAA MGRGKIAIRRIENRTTRQVTFSKRRGGLFKKTHELSVLCDAQIALIVFSSNGKLFEYCTQTTWY*
BLAST of MELO3C007017 vs. Swiss-Prot
Match: FBP24_PETHY (MADS-box protein FBP24 OS=Petunia hybrida GN=FBP24 PE=1 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 2.2e-22 Identity = 49/60 (81.67%), Postives = 53/60 (88.33%), Query Frame = 1
BLAST of MELO3C007017 vs. Swiss-Prot
Match: DEF21_ANTMA (MADS-box protein defh21 OS=Antirrhinum majus GN=DEFH21 PE=2 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 7.0e-21 Identity = 48/59 (81.36%), Postives = 50/59 (84.75%), Query Frame = 1
BLAST of MELO3C007017 vs. Swiss-Prot
Match: GGM13_GNEGN (MADS-box protein GGM13 OS=Gnetum gnemon GN=GGM13 PE=2 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 4.6e-20 Identity = 46/62 (74.19%), Postives = 52/62 (83.87%), Query Frame = 1
BLAST of MELO3C007017 vs. Swiss-Prot
Match: MAD29_ORYSJ (MADS-box transcription factor 29 OS=Oryza sativa subsp. japonica GN=MADS29 PE=2 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 1.3e-19 Identity = 43/61 (70.49%), Postives = 51/61 (83.61%), Query Frame = 1
BLAST of MELO3C007017 vs. Swiss-Prot
Match: AGL8_ARATH (Agamous-like MADS-box protein AGL8 OS=Arabidopsis thaliana GN=AGL8 PE=1 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 3.9e-19 Identity = 43/61 (70.49%), Postives = 50/61 (81.97%), Query Frame = 1
BLAST of MELO3C007017 vs. TrEMBL
Match: B9I4N6_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0012s14770g PE=4 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 1.3e-21 Identity = 51/62 (82.26%), Postives = 58/62 (93.55%), Query Frame = 1
BLAST of MELO3C007017 vs. TrEMBL
Match: B9HGK3_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0007s07620g PE=4 SV=2) HSP 1 Score: 106.3 bits (264), Expect = 1.4e-20 Identity = 51/60 (85.00%), Postives = 55/60 (91.67%), Query Frame = 1
BLAST of MELO3C007017 vs. TrEMBL
Match: A0A0D2TWH7_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_013G069000 PE=4 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 2.4e-20 Identity = 50/60 (83.33%), Postives = 55/60 (91.67%), Query Frame = 1
BLAST of MELO3C007017 vs. TrEMBL
Match: A0A0D2W3J3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_013G069000 PE=4 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 2.4e-20 Identity = 50/60 (83.33%), Postives = 55/60 (91.67%), Query Frame = 1
BLAST of MELO3C007017 vs. TrEMBL
Match: A0A0B0PPB3_GOSAR (Protein TRANSPARENT TESTA 16-like protein OS=Gossypium arboreum GN=F383_33609 PE=4 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 2.4e-20 Identity = 50/60 (83.33%), Postives = 55/60 (91.67%), Query Frame = 1
BLAST of MELO3C007017 vs. TAIR10
Match: AT5G60910.1 (AT5G60910.1 AGAMOUS-like 8) HSP 1 Score: 94.7 bits (234), Expect = 2.2e-20 Identity = 43/61 (70.49%), Postives = 50/61 (81.97%), Query Frame = 1
BLAST of MELO3C007017 vs. TAIR10
Match: AT1G69120.1 (AT1G69120.1 K-box region and MADS-box transcription factor family protein ) HSP 1 Score: 92.4 bits (228), Expect = 1.1e-19 Identity = 41/61 (67.21%), Postives = 49/61 (80.33%), Query Frame = 1
BLAST of MELO3C007017 vs. TAIR10
Match: AT5G23260.2 (AT5G23260.2 K-box region and MADS-box transcription factor family protein ) HSP 1 Score: 91.3 bits (225), Expect = 2.4e-19 Identity = 43/60 (71.67%), Postives = 49/60 (81.67%), Query Frame = 1
BLAST of MELO3C007017 vs. TAIR10
Match: AT1G24260.2 (AT1G24260.2 K-box region and MADS-box transcription factor family protein ) HSP 1 Score: 90.5 bits (223), Expect = 4.1e-19 Identity = 38/62 (61.29%), Postives = 52/62 (83.87%), Query Frame = 1
BLAST of MELO3C007017 vs. TAIR10
Match: AT2G22540.1 (AT2G22540.1 K-box region and MADS-box transcription factor family protein ) HSP 1 Score: 90.5 bits (223), Expect = 4.1e-19 Identity = 43/61 (70.49%), Postives = 48/61 (78.69%), Query Frame = 1
BLAST of MELO3C007017 vs. NCBI nr
Match: gi|778721776|ref|XP_004134531.2| (PREDICTED: MADS-box protein FBP24 isoform X1 [Cucumis sativus]) HSP 1 Score: 125.9 bits (315), Expect = 2.5e-26 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 1
BLAST of MELO3C007017 vs. NCBI nr
Match: gi|659077936|ref|XP_008439462.1| (PREDICTED: MADS-box protein FBP24 isoform X1 [Cucumis melo]) HSP 1 Score: 125.9 bits (315), Expect = 2.5e-26 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 1
BLAST of MELO3C007017 vs. NCBI nr
Match: gi|778721794|ref|XP_011658354.1| (PREDICTED: MADS-box protein FBP24 isoform X6 [Cucumis sativus]) HSP 1 Score: 125.9 bits (315), Expect = 2.5e-26 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 1
BLAST of MELO3C007017 vs. NCBI nr
Match: gi|659077944|ref|XP_008439466.1| (PREDICTED: MADS-box protein FBP24 isoform X5 [Cucumis melo]) HSP 1 Score: 125.9 bits (315), Expect = 2.5e-26 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 1
BLAST of MELO3C007017 vs. NCBI nr
Match: gi|778721783|ref|XP_011658351.1| (PREDICTED: MADS-box protein FBP24 isoform X3 [Cucumis sativus]) HSP 1 Score: 125.9 bits (315), Expect = 2.5e-26 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|