MELO3C006913 (gene) Melon (DHL92) v3.5.1

NameMELO3C006913
Typegene
OrganismCucumis melo (Melon (DHL92) v3.5.1)
DescriptionBifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Locationchr6 : 7216131 .. 7216343 (-)
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGCGTCGGCATAAGGTCCGTCTTGAAGAGGAACTCCCGACGCCACTTTGGGCAACGCATGTCAGGGCATCGGGAGAGGCATTCCTGACAGCGTGTTGGTACGACATCAGGAATGCTTCTCTCGACGCCGTGAAAAACGTTGGCATATCCTTTCTCGACATTTTATCATTTTTCCGACGTTTTTGTGCGTTGGGAGTACCTCGTCTCTTGTAG

mRNA sequence

ATGCGTCGGCATAAGGTCCGTCTTGAAGAGGAACTCCCGACGCCACTTTGGGCAACGCATGTCAGGGCATCGGGAGAGGCATTCCTGACAGCGTGTTGGTACGACATCAGGAATGCTTCTCTCGACGCCGTGAAAAACGTTGGCATATCCTTTCTCGACATTTTATCATTTTTCCGACGTTTTTGTGCGTTGGGAGTACCTCGTCTCTTGTAG

Coding sequence (CDS)

ATGCGTCGGCATAAGGTCCGTCTTGAAGAGGAACTCCCGACGCCACTTTGGGCAACGCATGTCAGGGCATCGGGAGAGGCATTCCTGACAGCGTGTTGGTACGACATCAGGAATGCTTCTCTCGACGCCGTGAAAAACGTTGGCATATCCTTTCTCGACATTTTATCATTTTTCCGACGTTTTTGTGCGTTGGGAGTACCTCGTCTCTTGTAG

Protein sequence

MRRHKVRLEEELPTPLWATHVRASGEAFLTACWYDIRNASLDAVKNVGISFLDILSFFRRFCALGVPRLL*
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008150 biological_process
cellular_component GO:0005575 cellular_component
molecular_function GO:0003674 molecular_function

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
MELO3C006913T1MELO3C006913T1mRNA


The following gene(s) are orthologous to this gene:

None

The following gene(s) are paralogous to this gene:

None

The following block(s) are covering this gene:
GeneOrganismBlock
MELO3C006913Cucumber (Gy14) v2cgybmeB200
MELO3C006913Cucumber (Gy14) v2cgybmeB353
MELO3C006913Silver-seed gourdcarmeB0498
MELO3C006913Silver-seed gourdcarmeB0709
MELO3C006913Silver-seed gourdcarmeB0732
MELO3C006913Silver-seed gourdcarmeB0966
MELO3C006913Cucumber (Chinese Long) v3cucmeB236
MELO3C006913Cucumber (Chinese Long) v3cucmeB256
MELO3C006913Cucumber (Chinese Long) v3cucmeB415
MELO3C006913Watermelon (97103) v2mewmbB434
MELO3C006913Watermelon (97103) v2mewmbB437
MELO3C006913Wax gourdmewgoB541
MELO3C006913Melon (DHL92) v3.5.1memeB150
MELO3C006913Cucumber (Gy14) v1cgymeB142
MELO3C006913Cucumber (Gy14) v1cgymeB438
MELO3C006913Cucumber (Gy14) v1cgymeB497
MELO3C006913Cucurbita maxima (Rimu)cmameB296
MELO3C006913Cucurbita maxima (Rimu)cmameB375
MELO3C006913Cucurbita maxima (Rimu)cmameB579
MELO3C006913Cucurbita moschata (Rifu)cmomeB289
MELO3C006913Cucurbita moschata (Rifu)cmomeB368
MELO3C006913Cucurbita moschata (Rifu)cmomeB567
MELO3C006913Cucurbita moschata (Rifu)cmomeB835
MELO3C006913Wild cucumber (PI 183967)cpimeB230
MELO3C006913Wild cucumber (PI 183967)cpimeB249
MELO3C006913Cucumber (Chinese Long) v2cumeB236
MELO3C006913Cucumber (Chinese Long) v2cumeB254
MELO3C006913Watermelon (Charleston Gray)mewcgB427
MELO3C006913Watermelon (Charleston Gray)mewcgB433
MELO3C006913Watermelon (97103) v1mewmB461
MELO3C006913Watermelon (97103) v1mewmB470
MELO3C006913Cucurbita pepo (Zucchini)cpemeB043
MELO3C006913Cucurbita pepo (Zucchini)cpemeB190
MELO3C006913Cucurbita pepo (Zucchini)cpemeB701
MELO3C006913Bottle gourd (USVL1VR-Ls)lsimeB375
MELO3C006913Bottle gourd (USVL1VR-Ls)lsimeB379