MELO3C006906.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCCTTAGGCACGACCATACATAACATAGAAATCACACTTGGGAAGGGGGGACAATTAGCTAGAGCAGCAGGTGCTATAGTAAAATGGATTACAAAAGAGGAGAAATCGGCCACATTCAAATTACCTTTTGGGGAGGTTCGTTTGATATCCAAAAATTGCTCAGTAACAGTCGGACAAGTGGAGAATGCAGGGGTTAACCAGAAAAGTTTGGGTAGAGCCGGATCTCAATGTTGGCTAGGTAAGCATCTTGTAGTCAAAGAAGTAGTTATGAACCCTGTAGACCATCCCCATGGGGGTGGTGAAGGAAGGGTCCCAATTGGTCGAAAAAAACCCGCAACCCTTTGGGGTTATCCTGCACTCGAAGAAGTAGAAAAAGGAATCAATATAGTGAGAATTTGA ATGCCCTTAGGCACGACCATACATAACATAGAAATCACACTTGGGAAGGGGGGACAATTAGCTAGAGCAGCAGGTGCTATAGTAAAATGGATTACAAAAGAGGAGAAATCGGCCACATTCAAATTACCTTTTGGGGAGGTTCGTTTGATATCCAAAAATTGCTCAGTAACAGTCGGACAAGTGGAGAATGCAGGGGTTAACCAGAAAAGTTTGGGTAGAGCCGGATCTCAATGTTGGCTAGGTAAGCATCTTGTAGTCAAAGAAGTAGTTATGAACCCTGTAGACCATCCCCATGGGGGTGGTGAAGGAAGGGTCCCAATTGGTCGAAAAAAACCCGCAACCCTTTGGGGTTATCCTGCACTCGAAGAAGTAGAAAAAGGAATCAATATAGTGAGAATTTGA ATGCCCTTAGGCACGACCATACATAACATAGAAATCACACTTGGGAAGGGGGGACAATTAGCTAGAGCAGCAGGTGCTATAGTAAAATGGATTACAAAAGAGGAGAAATCGGCCACATTCAAATTACCTTTTGGGGAGGTTCGTTTGATATCCAAAAATTGCTCAGTAACAGTCGGACAAGTGGAGAATGCAGGGGTTAACCAGAAAAGTTTGGGTAGAGCCGGATCTCAATGTTGGCTAGGTAAGCATCTTGTAGTCAAAGAAGTAGTTATGAACCCTGTAGACCATCCCCATGGGGGTGGTGAAGGAAGGGTCCCAATTGGTCGAAAAAAACCCGCAACCCTTTGGGGTTATCCTGCACTCGAAGAAGTAGAAAAAGGAATCAATATAGTGAGAATTTGA MPLGTTIHNIEITLGKGGQLARAAGAIVKWITKEEKSATFKLPFGEVRLISKNCSVTVGQVENAGVNQKSLGRAGSQCWLGKHLVVKEVVMNPVDHPHGGGEGRVPIGRKKPATLWGYPALEEVEKGINIVRI
BLAST of MELO3C006906.2 vs. NCBI nr
Match: AFU96017.1 (Rpl2, partial (chloroplast) [Balanops pachyphylla]) HSP 1 Score: 217.2 bits (552), Expect = 3.3e-53 Identity = 105/121 (86.78%), Postives = 108/121 (89.26%), Query Frame = 0
BLAST of MELO3C006906.2 vs. NCBI nr
Match: YP_009263072.1 (ribosomal protein L2 (chloroplast) [Angelesia splendens] >YP_009263093.1 ribosomal protein L2 (chloroplast) [Angelesia splendens] >ANJ17169.1 ribosomal protein L2 (chloroplast) [Angelesia splendens] >ANJ17170.1 ribosomal protein L2 (chloroplast) [Angelesia splendens]) HSP 1 Score: 216.5 bits (550), Expect = 5.6e-53 Identity = 104/121 (85.95%), Postives = 107/121 (88.43%), Query Frame = 0
BLAST of MELO3C006906.2 vs. NCBI nr
Match: YP_009263176.1 (ribosomal protein L2 (chloroplast) [Atuna racemosa] >ANJ17278.1 ribosomal protein L2 (chloroplast) [Atuna racemosa]) HSP 1 Score: 216.5 bits (550), Expect = 5.6e-53 Identity = 104/121 (85.95%), Postives = 107/121 (88.43%), Query Frame = 0
BLAST of MELO3C006906.2 vs. NCBI nr
Match: YP_004072503.1 (ribosomal protein L2 (chloroplast) [Corynocarpus laevigatus] >YP_004072523.1 ribosomal protein L2 (chloroplast) [Corynocarpus laevigatus] >ADO60351.1 ribosomal protein L2 (chloroplast) [Corynocarpus laevigatus] >ADO60371.1 ribosomal protein L2 (chloroplast) [Corynocarpus laevigatus] >AEK71459.1 ribosomal protein L2 (plastid) [Coriaria nepalensis]) HSP 1 Score: 215.7 bits (548), Expect = 9.5e-53 Identity = 104/121 (85.95%), Postives = 107/121 (88.43%), Query Frame = 0
BLAST of MELO3C006906.2 vs. NCBI nr
Match: AEK71791.1 (ribosomal protein L2 (plastid) [Malesherbia linearifolia]) HSP 1 Score: 215.7 bits (548), Expect = 9.5e-53 Identity = 104/121 (85.95%), Postives = 107/121 (88.43%), Query Frame = 0
BLAST of MELO3C006906.2 vs. TAIR10
Match: ATCG00830.1 (ribosomal protein L2) HSP 1 Score: 211.5 bits (537), Expect = 3.3e-55 Identity = 101/121 (83.47%), Postives = 105/121 (86.78%), Query Frame = 0
BLAST of MELO3C006906.2 vs. TAIR10
Match: ATCG01310.1 (ribosomal protein L2) HSP 1 Score: 211.5 bits (537), Expect = 3.3e-55 Identity = 101/121 (83.47%), Postives = 105/121 (86.78%), Query Frame = 0
BLAST of MELO3C006906.2 vs. TAIR10
Match: AT2G44065.1 (Ribosomal protein L2 family) HSP 1 Score: 97.8 bits (242), Expect = 5.3e-21 Identity = 51/123 (41.46%), Postives = 66/123 (53.66%), Query Frame = 0
BLAST of MELO3C006906.2 vs. TAIR10
Match: AT3G51190.1 (Ribosomal protein L2 family) HSP 1 Score: 74.7 bits (182), Expect = 4.8e-14 Identity = 44/112 (39.29%), Postives = 59/112 (52.68%), Query Frame = 0
BLAST of MELO3C006906.2 vs. TAIR10
Match: AT4G36130.1 (Ribosomal protein L2 family) HSP 1 Score: 68.2 bits (165), Expect = 4.5e-12 Identity = 40/112 (35.71%), Postives = 57/112 (50.89%), Query Frame = 0
BLAST of MELO3C006906.2 vs. Swiss-Prot
Match: sp|Q4VZK5|RK2_CUCSA (50S ribosomal protein L2, chloroplastic OS=Cucumis sativus OX=3659 GN=rpl2-A PE=3 SV=1) HSP 1 Score: 215.7 bits (548), Expect = 3.1e-55 Identity = 104/121 (85.95%), Postives = 107/121 (88.43%), Query Frame = 0
BLAST of MELO3C006906.2 vs. Swiss-Prot
Match: sp|Q14F95|RK2A_POPAL (50S ribosomal protein L2-A, chloroplastic OS=Populus alba OX=43335 GN=rpl2-A PE=3 SV=1) HSP 1 Score: 214.5 bits (545), Expect = 6.9e-55 Identity = 103/121 (85.12%), Postives = 107/121 (88.43%), Query Frame = 0
BLAST of MELO3C006906.2 vs. Swiss-Prot
Match: sp|Q14FB6|RK2B_POPAL (50S ribosomal protein L2-B, chloroplastic OS=Populus alba OX=43335 GN=rpl2-B PE=3 SV=1) HSP 1 Score: 214.5 bits (545), Expect = 6.9e-55 Identity = 103/121 (85.12%), Postives = 107/121 (88.43%), Query Frame = 0
BLAST of MELO3C006906.2 vs. Swiss-Prot
Match: sp|A4GYV2|RK2_POPTR (50S ribosomal protein L2, chloroplastic OS=Populus trichocarpa OX=3694 GN=rpl2-A PE=3 SV=1) HSP 1 Score: 214.5 bits (545), Expect = 6.9e-55 Identity = 103/121 (85.12%), Postives = 107/121 (88.43%), Query Frame = 0
BLAST of MELO3C006906.2 vs. Swiss-Prot
Match: sp|A4QJF6|RK2_AETCO (50S ribosomal protein L2, chloroplastic OS=Aethionema cordifolium OX=434059 GN=rpl2-A PE=3 SV=1) HSP 1 Score: 214.2 bits (544), Expect = 9.1e-55 Identity = 103/121 (85.12%), Postives = 106/121 (87.60%), Query Frame = 0
BLAST of MELO3C006906.2 vs. TrEMBL
Match: tr|K4KP98|K4KP98_9ROSI (Rpl2 (Fragment) OS=Balanops pachyphylla OX=1241920 GN=rpl2 PE=3 SV=1) HSP 1 Score: 217.2 bits (552), Expect = 2.2e-53 Identity = 105/121 (86.78%), Postives = 108/121 (89.26%), Query Frame = 0
BLAST of MELO3C006906.2 vs. TrEMBL
Match: tr|A0A191VN78|A0A191VN78_9ROSI (50S ribosomal protein L2, chloroplastic OS=Angelesia splendens OX=1856776 GN=rpl2 PE=3 SV=1) HSP 1 Score: 216.5 bits (550), Expect = 3.7e-53 Identity = 104/121 (85.95%), Postives = 107/121 (88.43%), Query Frame = 0
BLAST of MELO3C006906.2 vs. TrEMBL
Match: tr|A0A191VNJ5|A0A191VNJ5_9ROSI (Ribosomal protein L2 OS=Atuna racemosa OX=82151 GN=rpl2 PE=4 SV=1) HSP 1 Score: 216.5 bits (550), Expect = 3.7e-53 Identity = 104/121 (85.95%), Postives = 107/121 (88.43%), Query Frame = 0
BLAST of MELO3C006906.2 vs. TrEMBL
Match: tr|A0A286KTY1|A0A286KTY1_9ROSI (50S ribosomal protein L2, chloroplastic OS=Gynostemma cardiospermum OX=1739658 GN=rpl2 PE=3 SV=1) HSP 1 Score: 215.7 bits (548), Expect = 6.3e-53 Identity = 104/121 (85.95%), Postives = 107/121 (88.43%), Query Frame = 0
BLAST of MELO3C006906.2 vs. TrEMBL
Match: tr|A0A2L1IPH0|A0A2L1IPH0_BYRCR (50S ribosomal protein L2, chloroplastic OS=Byrsonima crassifolia OX=4270 GN=rpl2 PE=3 SV=1) HSP 1 Score: 215.7 bits (548), Expect = 6.3e-53 Identity = 104/121 (85.95%), Postives = 107/121 (88.43%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |