MELO3C006906 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCCTTAGGCACGACCATACATAACATAGAAATCACACTTGGGAAGGGGGGACAATTAGCTAGAGCAGCAGGTGCTATAGTAAAATGGATTACAAAAGAGGAGAAATCGGCCACATTCAAATTACCTTTTGGGGAGGTTCGTTTGATATCCAAAAATTGCTCAGTAACAGTCGGACAAGTGGAGAATGCAGGGGTTAACCAGAAAAGTTTGGGTAGAGCCGGATCTCAATGTTGGCTAGGTAAGCATCTTGTAGTCAAAGAAGTAGTTATGAACCCTGTAGACCATCCCCATGGGGGTGGTGAAGGAAGGGTCCCAATTGGTCGAAAAAAACCCGCAACCCTTTGGGGTTATCCTGCACTCGAAGAAGTAGAAAAAGGAATCAATATAGTGAGAATTTGA ATGCCCTTAGGCACGACCATACATAACATAGAAATCACACTTGGGAAGGGGGGACAATTAGCTAGAGCAGCAGGTGCTATAGTAAAATGGATTACAAAAGAGGAGAAATCGGCCACATTCAAATTACCTTTTGGGGAGGTTCGTTTGATATCCAAAAATTGCTCAGTAACAGTCGGACAAGTGGAGAATGCAGGGGTTAACCAGAAAAGTTTGGGTAGAGCCGGATCTCAATGTTGGCTAGGTAAGCATCTTGTAGTCAAAGAAGTAGTTATGAACCCTGTAGACCATCCCCATGGGGGTGGTGAAGGAAGGGTCCCAATTGGTCGAAAAAAACCCGCAACCCTTTGGGGTTATCCTGCACTCGAAGAAGTAGAAAAAGGAATCAATATAGTGAGAATTTGA ATGCCCTTAGGCACGACCATACATAACATAGAAATCACACTTGGGAAGGGGGGACAATTAGCTAGAGCAGCAGGTGCTATAGTAAAATGGATTACAAAAGAGGAGAAATCGGCCACATTCAAATTACCTTTTGGGGAGGTTCGTTTGATATCCAAAAATTGCTCAGTAACAGTCGGACAAGTGGAGAATGCAGGGGTTAACCAGAAAAGTTTGGGTAGAGCCGGATCTCAATGTTGGCTAGGTAAGCATCTTGTAGTCAAAGAAGTAGTTATGAACCCTGTAGACCATCCCCATGGGGGTGGTGAAGGAAGGGTCCCAATTGGTCGAAAAAAACCCGCAACCCTTTGGGGTTATCCTGCACTCGAAGAAGTAGAAAAAGGAATCAATATAGTGAGAATTTGA MPLGTTIHNIEITLGKGGQLARAAGAIVKWITKEEKSATFKLPFGEVRLISKNCSVTVGQVENAGVNQKSLGRAGSQCWLGKHLVVKEVVMNPVDHPHGGGEGRVPIGRKKPATLWGYPALEEVEKGINIVRI*
BLAST of MELO3C006906 vs. Swiss-Prot
Match: RK2_CUCSA (50S ribosomal protein L2, chloroplastic OS=Cucumis sativus GN=rpl2-A PE=3 SV=1) HSP 1 Score: 213.0 bits (541), Expect = 2.0e-54 Identity = 104/121 (85.95%), Postives = 106/121 (87.60%), Query Frame = 1
BLAST of MELO3C006906 vs. Swiss-Prot
Match: RK2A_POPAL (50S ribosomal protein L2-A, chloroplastic OS=Populus alba GN=rpl2-A PE=3 SV=1) HSP 1 Score: 211.8 bits (538), Expect = 4.5e-54 Identity = 103/121 (85.12%), Postives = 106/121 (87.60%), Query Frame = 1
BLAST of MELO3C006906 vs. Swiss-Prot
Match: RK2_POPTR (50S ribosomal protein L2, chloroplastic OS=Populus trichocarpa GN=rpl2-A PE=3 SV=1) HSP 1 Score: 211.8 bits (538), Expect = 4.5e-54 Identity = 103/121 (85.12%), Postives = 106/121 (87.60%), Query Frame = 1
BLAST of MELO3C006906 vs. Swiss-Prot
Match: RK2B_POPAL (50S ribosomal protein L2-B, chloroplastic OS=Populus alba GN=rpl2-B PE=3 SV=1) HSP 1 Score: 211.8 bits (538), Expect = 4.5e-54 Identity = 103/121 (85.12%), Postives = 106/121 (87.60%), Query Frame = 1
BLAST of MELO3C006906 vs. Swiss-Prot
Match: RK2_MANES (50S ribosomal protein L2, chloroplastic OS=Manihot esculenta GN=rpl2-A PE=3 SV=1) HSP 1 Score: 211.5 bits (537), Expect = 5.8e-54 Identity = 103/121 (85.12%), Postives = 105/121 (86.78%), Query Frame = 1
BLAST of MELO3C006906 vs. TrEMBL
Match: K4KP98_9ROSI (Rpl2 (Fragment) OS=Balanops pachyphylla GN=rpl2 PE=3 SV=1) HSP 1 Score: 214.5 bits (545), Expect = 7.7e-53 Identity = 105/121 (86.78%), Postives = 108/121 (89.26%), Query Frame = 1
BLAST of MELO3C006906 vs. TrEMBL
Match: W8E241_9ROSI (Ribosomal protein L2 OS=Cucumis hystrix GN=rpl2 PE=3 SV=1) HSP 1 Score: 213.0 bits (541), Expect = 2.2e-52 Identity = 104/121 (85.95%), Postives = 107/121 (88.43%), Query Frame = 1
BLAST of MELO3C006906 vs. TrEMBL
Match: A0A0S2IHS2_CUCPE (Ribosomal protein L2 OS=Cucurbita pepo subsp. pepo GN=rpl2 PE=3 SV=1) HSP 1 Score: 213.0 bits (541), Expect = 2.2e-52 Identity = 104/121 (85.95%), Postives = 107/121 (88.43%), Query Frame = 1
BLAST of MELO3C006906 vs. TrEMBL
Match: A0A109X1F9_GYNPE (50S ribosomal protein L2, chloroplastic OS=Gynostemma pentaphyllum GN=rpl2 PE=3 SV=1) HSP 1 Score: 213.0 bits (541), Expect = 2.2e-52 Identity = 104/121 (85.95%), Postives = 107/121 (88.43%), Query Frame = 1
BLAST of MELO3C006906 vs. TrEMBL
Match: A0A0S2IEF7_9ROSI (Ribosomal protein L2 OS=Cucurbita ficifolia GN=rpl2 PE=3 SV=1) HSP 1 Score: 213.0 bits (541), Expect = 2.2e-52 Identity = 104/121 (85.95%), Postives = 107/121 (88.43%), Query Frame = 1
BLAST of MELO3C006906 vs. TAIR10
Match: ATCG00830.1 (ATCG00830.1 ribosomal protein L2) HSP 1 Score: 208.8 bits (530), Expect = 2.1e-54 Identity = 101/121 (83.47%), Postives = 104/121 (85.95%), Query Frame = 1
BLAST of MELO3C006906 vs. TAIR10
Match: ATCG01310.1 (ATCG01310.1 ribosomal protein L2) HSP 1 Score: 208.8 bits (530), Expect = 2.1e-54 Identity = 101/121 (83.47%), Postives = 104/121 (85.95%), Query Frame = 1
BLAST of MELO3C006906 vs. TAIR10
Match: AT2G44065.1 (AT2G44065.1 Ribosomal protein L2 family) HSP 1 Score: 94.7 bits (234), Expect = 4.5e-20 Identity = 51/123 (41.46%), Postives = 64/123 (52.03%), Query Frame = 1
BLAST of MELO3C006906 vs. TAIR10
Match: AT3G51190.1 (AT3G51190.1 Ribosomal protein L2 family) HSP 1 Score: 73.2 bits (178), Expect = 1.4e-13 Identity = 44/112 (39.29%), Postives = 57/112 (50.89%), Query Frame = 1
BLAST of MELO3C006906 vs. TAIR10
Match: AT4G36130.1 (AT4G36130.1 Ribosomal protein L2 family) HSP 1 Score: 66.6 bits (161), Expect = 1.3e-11 Identity = 40/112 (35.71%), Postives = 55/112 (49.11%), Query Frame = 1
BLAST of MELO3C006906 vs. NCBI nr
Match: gi|408902749|gb|AFU96017.1| (Rpl2, partial (chloroplast) [Balanops pachyphylla]) HSP 1 Score: 214.5 bits (545), Expect = 1.1e-52 Identity = 105/121 (86.78%), Postives = 108/121 (89.26%), Query Frame = 1
BLAST of MELO3C006906 vs. NCBI nr
Match: gi|1002166170|ref|YP_009236338.1| (ribosomal protein L2 (chloroplast) [Gynostemma pentaphyllum]) HSP 1 Score: 213.0 bits (541), Expect = 3.2e-52 Identity = 104/121 (85.95%), Postives = 107/121 (88.43%), Query Frame = 1
BLAST of MELO3C006906 vs. NCBI nr
Match: gi|952954360|gb|ALO21724.1| (ribosomal protein L2 (plastid) [Cucurbita argyrosperma]) HSP 1 Score: 213.0 bits (541), Expect = 3.2e-52 Identity = 104/121 (85.95%), Postives = 107/121 (88.43%), Query Frame = 1
BLAST of MELO3C006906 vs. NCBI nr
Match: gi|317046214|ref|YP_004072503.1| (ribosomal protein L2 [Corynocarpus laevigata]) HSP 1 Score: 213.0 bits (541), Expect = 3.2e-52 Identity = 104/121 (85.95%), Postives = 107/121 (88.43%), Query Frame = 1
BLAST of MELO3C006906 vs. NCBI nr
Match: gi|590000473|ref|YP_009004102.1| (ribosomal protein L2 [Cucumis hystrix]) HSP 1 Score: 213.0 bits (541), Expect = 3.2e-52 Identity = 104/121 (85.95%), Postives = 107/121 (88.43%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |