MELO3C006825 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAGAGCAAAAAAGGATTTCTGAAGGTTTAATTACTGAATCACTTACCAACGATATGTTTTGGGTTTGTTTAGATAATGAGGATCCAATTCTAGGTTACGTTTCAGGAAGGATTCAACATAGTTTTATCCATATACTAGGTAATAGAGAGTAAAAAAATTCAGTAAGTTGTTACAATTCAATCAGGACCAAAAGGCGTATAATTTATAGACTACGAAACAAAGATTCGAATGATTAG ATGAAAGAGCAAAAAAGGATTTCTGAAGGTTTAATTACTGAATCACTTACCAACGATATGTTTTGGGTTTGTTTAGATAATGAGGATCCAATTCTAGGTTACGTTTCAGGAAGGATTCAACATAGTTTTATCCATATACTAGTAAGTTGTTACAATTCAATCAGGACCAAAAGGCGTATAATTTATAGACTACGAAACAAAGATTCGAATGATTAG ATGAAAGAGCAAAAAAGGATTTCTGAAGGTTTAATTACTGAATCACTTACCAACGATATGTTTTGGGTTTGTTTAGATAATGAGGATCCAATTCTAGGTTACGTTTCAGGAAGGATTCAACATAGTTTTATCCATATACTAGTAAGTTGTTACAATTCAATCAGGACCAAAAGGCGTATAATTTATAGACTACGAAACAAAGATTCGAATGATTAG MKEQKRISEGLITESLTNDMFWVCLDNEDPILGYVSGRIQHSFIHILVSCYNSIRTKRRIIYRLRNKDSND*
BLAST of MELO3C006825 vs. Swiss-Prot
Match: IF1C_CUCSA (Translation initiation factor IF-1, chloroplastic OS=Cucumis sativus GN=infA PE=3 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 2.4e-30 Identity = 65/75 (86.67%), Postives = 67/75 (89.33%), Query Frame = 1
BLAST of MELO3C006825 vs. Swiss-Prot
Match: IF1C_SPIOL (Translation initiation factor IF-1, chloroplastic OS=Spinacia oleracea GN=infA PE=3 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.1e-19 Identity = 56/79 (70.89%), Postives = 57/79 (72.15%), Query Frame = 1
BLAST of MELO3C006825 vs. Swiss-Prot
Match: IF1C_NUPAD (Translation initiation factor IF-1, chloroplastic OS=Nuphar advena GN=infA PE=3 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 1.9e-19 Identity = 55/79 (69.62%), Postives = 57/79 (72.15%), Query Frame = 1
BLAST of MELO3C006825 vs. Swiss-Prot
Match: IF1C_CABCA (Translation initiation factor IF-1, chloroplastic OS=Cabomba caroliniana GN=infA PE=3 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 1.9e-19 Identity = 55/79 (69.62%), Postives = 57/79 (72.15%), Query Frame = 1
BLAST of MELO3C006825 vs. Swiss-Prot
Match: IF1C_NYMAL (Translation initiation factor IF-1, chloroplastic OS=Nymphaea alba GN=infA PE=3 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 1.9e-19 Identity = 55/79 (69.62%), Postives = 57/79 (72.15%), Query Frame = 1
BLAST of MELO3C006825 vs. TrEMBL
Match: G3ETT2_CUCME (Translational initiation factor 1 OS=Cucumis melo subsp. melo GN=infA PE=4 SV=1) HSP 1 Score: 137.5 bits (345), Expect = 6.4e-30 Identity = 68/75 (90.67%), Postives = 70/75 (93.33%), Query Frame = 1
BLAST of MELO3C006825 vs. TrEMBL
Match: X2F7S7_LAGSI (Translational initiation factor 1 (Fragment) OS=Lagenaria siceraria GN=infA PE=4 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 5.6e-18 Identity = 49/58 (84.48%), Postives = 51/58 (87.93%), Query Frame = 1
BLAST of MELO3C006825 vs. TrEMBL
Match: C4P3M5_SIMCH (Translation initiation factor IF-1, chloroplastic OS=Simmondsia chinensis GN=infA PE=3 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 9.6e-18 Identity = 57/79 (72.15%), Postives = 59/79 (74.68%), Query Frame = 1
BLAST of MELO3C006825 vs. TrEMBL
Match: M1KEY7_XIPCA (Translation initiation factor IF-1 OS=Xiphidium caeruleum GN=infA PE=3 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 1.6e-17 Identity = 56/79 (70.89%), Postives = 59/79 (74.68%), Query Frame = 1
BLAST of MELO3C006825 vs. TrEMBL
Match: A0A067YPV6_NYMME (Translation initiation factor IF-1, chloroplastic OS=Nymphaea mexicana GN=infA PE=3 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 2.1e-17 Identity = 55/79 (69.62%), Postives = 59/79 (74.68%), Query Frame = 1
BLAST of MELO3C006825 vs. TAIR10
Match: AT4G11175.1 (AT4G11175.1 Nucleic acid-binding, OB-fold-like protein) HSP 1 Score: 60.5 bits (145), Expect = 5.0e-10 Identity = 35/72 (48.61%), Postives = 46/72 (63.89%), Query Frame = 1
BLAST of MELO3C006825 vs. NCBI nr
Match: gi|346578226|ref|YP_004841818.1| (translational initiation factor 1 [Cucumis melo subsp. melo]) HSP 1 Score: 137.5 bits (345), Expect = 9.2e-30 Identity = 68/75 (90.67%), Postives = 70/75 (93.33%), Query Frame = 1
BLAST of MELO3C006825 vs. NCBI nr
Match: gi|156630932|sp|A5J1W9.1|IF1C_CUCSA (RecName: Full=Translation initiation factor IF-1, chloroplastic) HSP 1 Score: 132.1 bits (331), Expect = 3.9e-28 Identity = 65/75 (86.67%), Postives = 69/75 (92.00%), Query Frame = 1
BLAST of MELO3C006825 vs. NCBI nr
Match: gi|595645256|gb|AHM88719.1| (translational initiation factor 1, partial (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 97.8 bits (242), Expect = 8.1e-18 Identity = 49/58 (84.48%), Postives = 51/58 (87.93%), Query Frame = 1
BLAST of MELO3C006825 vs. NCBI nr
Match: gi|237861975|gb|ACR24641.1| (initiation factor IF1 (chloroplast) [Simmondsia chinensis]) HSP 1 Score: 97.1 bits (240), Expect = 1.4e-17 Identity = 57/79 (72.15%), Postives = 59/79 (74.68%), Query Frame = 1
BLAST of MELO3C006825 vs. NCBI nr
Match: gi|126022794|ref|NP_054969.2| (translation initiation factor 1 [Spinacia oleracea]) HSP 1 Score: 96.7 bits (239), Expect = 1.8e-17 Identity = 56/79 (70.89%), Postives = 59/79 (74.68%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |