MELO3C006815 (gene) Melon (DHL92) v3.5.1

NameMELO3C006815
Typegene
OrganismCucumis melo (Melon (DHL92) v3.5.1)
DescriptionRibosomal protein PSRP-3/Ycf65
Locationchr6 : 6316924 .. 6317081 (+)
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGGAACGAGTGGCCCTGAAAGATGGCCCAAATAATCTTGATATCCCTGCTAGTCCCTACCATTTTTTCCCCACCATCGATATCTTCTTCTTTGAGTCTCAAACTACAATGAAACATAGAGAAATAAATGGTGTGATGATGATGGCGGTGGTGAAGGG

mRNA sequence

ATGGAACGAGTGGCCCTGAAAGATGGCCCAAATAATCTTGATATCCCTGCTAGTCCCTACCATTTTTTCCCCACCATCGATATCTTCTTCTTTGAGTCTCAAACTACAATGAAACATAGAGAAATAAATGGTGTGATGATGATGGCGGTGGTGAAGGG

Coding sequence (CDS)

ATGGAACGAGTGGCCCTGAAAGATGGCCCAAATAATCTTGATATCCCTGCTAGTCCCTACCATTTTTTCCCCACCATCGATATCTTCTTCTTTGAGTCTCAAACTACAATGAAACATAGAGAAATAAATGGTGTGATGATGATGGCGGTGGTGAAGGG

Protein sequence

MERVALKDGPNNLDIPASPYHFFPTIDIFFFESQTTMKHREINGVMMMAVVK
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008150 biological_process
cellular_component GO:0005575 cellular_component
molecular_function GO:0003674 molecular_function

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
MELO3C006815T1MELO3C006815T1mRNA


The following gene(s) are orthologous to this gene:

None

The following gene(s) are paralogous to this gene:

None

The following block(s) are covering this gene:
GeneOrganismBlock
MELO3C006815Silver-seed gourdcarmeB0381
MELO3C006815Silver-seed gourdcarmeB0859
MELO3C006815Silver-seed gourdcarmeB0911
MELO3C006815Cucumber (Chinese Long) v3cucmeB236
MELO3C006815Cucumber (Chinese Long) v3cucmeB414
MELO3C006815Cucumber (Chinese Long) v3cucmeB415
MELO3C006815Watermelon (97103) v2mewmbB424
MELO3C006815Watermelon (97103) v2mewmbB434
MELO3C006815Wax gourdmewgoB529
MELO3C006815Melon (DHL92) v3.5.1memeB015
MELO3C006815Cucumber (Gy14) v1cgymeB439
MELO3C006815Cucumber (Gy14) v1cgymeB497
MELO3C006815Cucurbita maxima (Rimu)cmameB278
MELO3C006815Cucurbita maxima (Rimu)cmameB296
MELO3C006815Cucurbita maxima (Rimu)cmameB582
MELO3C006815Cucurbita maxima (Rimu)cmameB692
MELO3C006815Cucurbita moschata (Rifu)cmomeB269
MELO3C006815Cucurbita moschata (Rifu)cmomeB289
MELO3C006815Cucurbita moschata (Rifu)cmomeB570
MELO3C006815Cucurbita moschata (Rifu)cmomeB685
MELO3C006815Wild cucumber (PI 183967)cpimeB230
MELO3C006815Wild cucumber (PI 183967)cpimeB400
MELO3C006815Wild cucumber (PI 183967)cpimeB403
MELO3C006815Cucumber (Chinese Long) v2cumeB236
MELO3C006815Cucumber (Chinese Long) v2cumeB405
MELO3C006815Watermelon (Charleston Gray)mewcgB422
MELO3C006815Watermelon (Charleston Gray)mewcgB427
MELO3C006815Watermelon (97103) v1mewmB461
MELO3C006815Watermelon (97103) v1mewmB481
MELO3C006815Cucurbita pepo (Zucchini)cpemeB177
MELO3C006815Cucurbita pepo (Zucchini)cpemeB190
MELO3C006815Cucurbita pepo (Zucchini)cpemeB414
MELO3C006815Cucurbita pepo (Zucchini)cpemeB697
MELO3C006815Bottle gourd (USVL1VR-Ls)lsimeB036
MELO3C006815Bottle gourd (USVL1VR-Ls)lsimeB379
MELO3C006815Cucumber (Gy14) v2cgybmeB200
MELO3C006815Cucumber (Gy14) v2cgybmeB350
MELO3C006815Cucumber (Gy14) v2cgybmeB353