MELO3C006621.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATCGGTTCTAGTTTGCCTTCTACATTACATACGTTGATTTGGTTCAAAAAAAAATATTTAACTTTGGTTTAAATTGCTATACGTTCCCTTACAAATGGATAGAGTCACAAGGTTGATTTCGGAGAGACCGGTAGTGATCTTTAGCAAAAGTACATGTTGCATGAGTCACACTGTCATGAGGTTGTTGAGTGGCTTTGGAGTTAACCCAGCAGTGCATGAGCTAGATCAGATCTCGAGAGGTAGAGAAGTGGAGCAAGCTCTCTCTAGGCTTGGATTCAATCCTACTGTTCCAGCTGTCTTCATTGGCGGTGAATTAGTTGGTGGTGCTAATGAAGTCATGAGTCTTCACCTTAATCGATCTCTTATTCCCATGCTTAGAAAAGCTGGTGCTCTATGGGTTTGAACTTCACCCTAGCTATATCGAATAAATTAACCGTCGTGATCATAGTTCATATGCTTAGATAAGAGCTAGTAC ATCGGTTCTAGTTTGCCTTCTACATTACATACGTTGATTTGGTTCAAAAAAAAATATTTAACTTTGGTTTAAATTGCTATACGTTCCCTTACAAATGGATAGAGTCACAAGGTTGATTTCGGAGAGACCGGTAGTGATCTTTAGCAAAAGTACATGTTGCATGAGTCACACTGTCATGAGGTTGTTGAGTGGCTTTGGAGTTAACCCAGCAGTGCATGAGCTAGATCAGATCTCGAGAGGTAGAGAAGTGGAGCAAGCTCTCTCTAGGCTTGGATTCAATCCTACTGTTCCAGCTGTCTTCATTGGCGGTGAATTAGTTGGTGGTGCTAATGAAGTCATGAGTCTTCACCTTAATCGATCTCTTATTCCCATGCTTAGAAAAGCTGGTGCTCTATGGGTTTGAACTTCACCCTAGCTATATCGAATAAATTAACCGTCGTGATCATAGTTCATATGCTTAGATAAGAGCTAGTAC ATGGATAGAGTCACAAGGTTGATTTCGGAGAGACCGGTAGTGATCTTTAGCAAAAGTACATGTTGCATGAGTCACACTGTCATGAGGTTGTTGAGTGGCTTTGGAGTTAACCCAGCAGTGCATGAGCTAGATCAGATCTCGAGAGGTAGAGAAGTGGAGCAAGCTCTCTCTAGGCTTGGATTCAATCCTACTGTTCCAGCTGTCTTCATTGGCGGTGAATTAGTTGGTGGTGCTAATGAAGTCATGAGTCTTCACCTTAATCGATCTCTTATTCCCATGCTTAGAAAAGCTGGTGCTCTATGGGTTTGA MDRVTRLISERPVVIFSKSTCCMSHTVMRLLSGFGVNPAVHELDQISRGREVEQALSRLGFNPTVPAVFIGGELVGGANEVMSLHLNRSLIPMLRKAGALWV
BLAST of MELO3C006621.2 vs. NCBI nr
Match: XP_004134195.1 (PREDICTED: monothiol glutaredoxin-S2 [Cucumis sativus] >XP_008438823.1 PREDICTED: monothiol glutaredoxin-S2 [Cucumis melo] >KGN57082.1 hypothetical protein Csa_3G152090 [Cucumis sativus]) HSP 1 Score: 206.8 bits (525), Expect = 3.4e-50 Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 0
BLAST of MELO3C006621.2 vs. NCBI nr
Match: XP_022138193.1 (monothiol glutaredoxin-S2 [Momordica charantia]) HSP 1 Score: 192.6 bits (488), Expect = 6.6e-46 Identity = 92/102 (90.20%), Postives = 101/102 (99.02%), Query Frame = 0
BLAST of MELO3C006621.2 vs. NCBI nr
Match: XP_022940998.1 (monothiol glutaredoxin-S2-like [Cucurbita moschata] >XP_022973724.1 monothiol glutaredoxin-S2-like [Cucurbita maxima] >XP_023540620.1 monothiol glutaredoxin-S2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 186.0 bits (471), Expect = 6.2e-44 Identity = 87/102 (85.29%), Postives = 97/102 (95.10%), Query Frame = 0
BLAST of MELO3C006621.2 vs. NCBI nr
Match: XP_015938975.1 (monothiol glutaredoxin-S2 [Arachis duranensis] >XP_016177719.1 monothiol glutaredoxin-S2 [Arachis ipaensis] >XP_025630059.1 monothiol glutaredoxin-S2-like [Arachis hypogaea]) HSP 1 Score: 179.5 bits (454), Expect = 5.8e-42 Identity = 84/102 (82.35%), Postives = 93/102 (91.18%), Query Frame = 0
BLAST of MELO3C006621.2 vs. NCBI nr
Match: XP_025611519.1 (monothiol glutaredoxin-S2-like [Arachis hypogaea]) HSP 1 Score: 177.9 bits (450), Expect = 1.7e-41 Identity = 83/102 (81.37%), Postives = 92/102 (90.20%), Query Frame = 0
BLAST of MELO3C006621.2 vs. TAIR10
Match: AT5G18600.1 (Thioredoxin superfamily protein) HSP 1 Score: 166.4 bits (420), Expect = 9.2e-42 Identity = 77/102 (75.49%), Postives = 90/102 (88.24%), Query Frame = 0
BLAST of MELO3C006621.2 vs. TAIR10
Match: AT4G15680.1 (Thioredoxin superfamily protein) HSP 1 Score: 156.8 bits (395), Expect = 7.3e-39 Identity = 68/102 (66.67%), Postives = 91/102 (89.22%), Query Frame = 0
BLAST of MELO3C006621.2 vs. TAIR10
Match: AT4G15690.1 (Thioredoxin superfamily protein) HSP 1 Score: 154.1 bits (388), Expect = 4.7e-38 Identity = 68/102 (66.67%), Postives = 90/102 (88.24%), Query Frame = 0
BLAST of MELO3C006621.2 vs. TAIR10
Match: AT4G15700.1 (Thioredoxin superfamily protein) HSP 1 Score: 152.9 bits (385), Expect = 1.1e-37 Identity = 67/102 (65.69%), Postives = 89/102 (87.25%), Query Frame = 0
BLAST of MELO3C006621.2 vs. TAIR10
Match: AT4G15670.1 (Thioredoxin superfamily protein) HSP 1 Score: 150.2 bits (378), Expect = 6.8e-37 Identity = 65/102 (63.73%), Postives = 89/102 (87.25%), Query Frame = 0
BLAST of MELO3C006621.2 vs. Swiss-Prot
Match: sp|Q8L8Z8|GRXS2_ARATH (Monothiol glutaredoxin-S2 OS=Arabidopsis thaliana OX=3702 GN=GRXS2 PE=3 SV=1) HSP 1 Score: 166.4 bits (420), Expect = 1.7e-40 Identity = 77/102 (75.49%), Postives = 90/102 (88.24%), Query Frame = 0
BLAST of MELO3C006621.2 vs. Swiss-Prot
Match: sp|O23419|GRXS4_ARATH (Monothiol glutaredoxin-S4 OS=Arabidopsis thaliana OX=3702 GN=GRXS4 PE=3 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 1.3e-37 Identity = 68/102 (66.67%), Postives = 91/102 (89.22%), Query Frame = 0
BLAST of MELO3C006621.2 vs. Swiss-Prot
Match: sp|O23420|GRXS5_ARATH (Monothiol glutaredoxin-S5 OS=Arabidopsis thaliana OX=3702 GN=GRXS5 PE=3 SV=1) HSP 1 Score: 154.1 bits (388), Expect = 8.5e-37 Identity = 68/102 (66.67%), Postives = 90/102 (88.24%), Query Frame = 0
BLAST of MELO3C006621.2 vs. Swiss-Prot
Match: sp|O23421|GRXS3_ARATH (Monothiol glutaredoxin-S3 OS=Arabidopsis thaliana OX=3702 GN=GRXS3 PE=3 SV=1) HSP 1 Score: 152.9 bits (385), Expect = 1.9e-36 Identity = 67/102 (65.69%), Postives = 89/102 (87.25%), Query Frame = 0
BLAST of MELO3C006621.2 vs. Swiss-Prot
Match: sp|Q6NLU2|GRXS7_ARATH (Monothiol glutaredoxin-S7 OS=Arabidopsis thaliana OX=3702 GN=GRXS7 PE=3 SV=2) HSP 1 Score: 150.2 bits (378), Expect = 1.2e-35 Identity = 65/102 (63.73%), Postives = 89/102 (87.25%), Query Frame = 0
BLAST of MELO3C006621.2 vs. TrEMBL
Match: tr|A0A1S3AY12|A0A1S3AY12_CUCME (monothiol glutaredoxin-S2 OS=Cucumis melo OX=3656 GN=LOC103483809 PE=4 SV=1) HSP 1 Score: 206.8 bits (525), Expect = 2.2e-50 Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 0
BLAST of MELO3C006621.2 vs. TrEMBL
Match: tr|A0A0A0L8Y9|A0A0A0L8Y9_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G152090 PE=4 SV=1) HSP 1 Score: 206.8 bits (525), Expect = 2.2e-50 Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 0
BLAST of MELO3C006621.2 vs. TrEMBL
Match: tr|I1MRF6|I1MRF6_SOYBN (Uncharacterized protein OS=Glycine max OX=3847 GN=100815509 PE=4 SV=1) HSP 1 Score: 177.2 bits (448), Expect = 1.9e-41 Identity = 83/102 (81.37%), Postives = 95/102 (93.14%), Query Frame = 0
BLAST of MELO3C006621.2 vs. TrEMBL
Match: tr|A0A151STF3|A0A151STF3_CAJCA (Monothiol glutaredoxin-S2 OS=Cajanus cajan OX=3821 GN=KK1_004347 PE=4 SV=1) HSP 1 Score: 176.4 bits (446), Expect = 3.3e-41 Identity = 83/102 (81.37%), Postives = 94/102 (92.16%), Query Frame = 0
BLAST of MELO3C006621.2 vs. TrEMBL
Match: tr|A0A0D2VNY3|A0A0D2VNY3_GOSRA (Uncharacterized protein OS=Gossypium raimondii OX=29730 GN=B456_011G187400 PE=4 SV=1) HSP 1 Score: 176.0 bits (445), Expect = 4.2e-41 Identity = 83/102 (81.37%), Postives = 92/102 (90.20%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |