MELO3C006618 (gene) Melon (DHL92) v3.5.1

NameMELO3C006618
Typegene
OrganismCucumis melo (Melon (DHL92) v3.5.1)
DescriptionZinc finger protein 407
Locationchr6 : 4605656 .. 4605940 (+)
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGAATTATAAAATTGAACAAACTTGGAAAAGGAGAAAAGCAGGCCGGAGATTAGGCGGTTCGGCCGATGATCGCAACGTTGAATTACCGGCGTCGGCACCGACTTCAATTAAGGAAAAAAGGAGTGCCGCGACATGCGTGTCGAAGGAGCTTGGCGAGTGCAATAAGTTCTTGCCGGAGAAGGAAAGGGAAATCTTCTGCACCAAACGGAGGAAGCTTAGCAAAACGGAGAATGACGGAAAACAACTCAAGAAGCCGATGATTTACGAAAAAATTAAATTTTGA

mRNA sequence

ATGAATTATAAAATTGAACAAACTTGGAAAAGGAGAAAAGCAGGCCGGAGATTAGGCGGTTCGGCCGATGATCGCAACGTTGAATTACCGGCGTCGGCACCGACTTCAATTAAGGAAAAAAGGAGTGCCGCGACATGCGTGTCGAAGGAGCTTGGCGAGTGCAATAAGTTCTTGCCGGAGAAGGAAAGGGAAATCTTCTGCACCAAACGGAGGAAGCTTAGCAAAACGGAGAATGACGGAAAACAACTCAAGAAGCCGATGATTTACGAAAAAATTAAATTTTGA

Coding sequence (CDS)

ATGAATTATAAAATTGAACAAACTTGGAAAAGGAGAAAAGCAGGCCGGAGATTAGGCGGTTCGGCCGATGATCGCAACGTTGAATTACCGGCGTCGGCACCGACTTCAATTAAGGAAAAAAGGAGTGCCGCGACATGCGTGTCGAAGGAGCTTGGCGAGTGCAATAAGTTCTTGCCGGAGAAGGAAAGGGAAATCTTCTGCACCAAACGGAGGAAGCTTAGCAAAACGGAGAATGACGGAAAACAACTCAAGAAGCCGATGATTTACGAAAAAATTAAATTTTGA

Protein sequence

MNYKIEQTWKRRKAGRRLGGSADDRNVELPASAPTSIKEKRSAATCVSKELGECNKFLPEKEREIFCTKRRKLSKTENDGKQLKKPMIYEKIKF*
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008150 biological_process
biological_process GO:0006629 lipid metabolic process
cellular_component GO:0005575 cellular_component
molecular_function GO:0003674 molecular_function
This gene is associated with the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
MU46712melon EST collection version 4.0transcribed_cluster

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
MELO3C006618T1MELO3C006618T1mRNA


The following transcribed_cluster feature(s) are associated with this gene:

Feature NameUnique NameType
MU46712MU46712transcribed_cluster


The following gene(s) are orthologous to this gene:

None

The following gene(s) are paralogous to this gene:

None

The following block(s) are covering this gene:
GeneOrganismBlock
MELO3C006618Cucurbita maxima (Rimu)cmameB242
MELO3C006618Cucurbita maxima (Rimu)cmameB342
MELO3C006618Cucurbita maxima (Rimu)cmameB763
MELO3C006618Cucurbita maxima (Rimu)cmameB850
MELO3C006618Cucurbita moschata (Rifu)cmomeB230
MELO3C006618Cucurbita moschata (Rifu)cmomeB335
MELO3C006618Cucurbita moschata (Rifu)cmomeB832
MELO3C006618Cucurbita moschata (Rifu)cmomeB755
MELO3C006618Wild cucumber (PI 183967)cpimeB230
MELO3C006618Wild cucumber (PI 183967)cpimeB501
MELO3C006618Cucumber (Chinese Long) v2cumeB236
MELO3C006618Cucumber (Chinese Long) v2cumeB499
MELO3C006618Watermelon (Charleston Gray)mewcgB427
MELO3C006618Watermelon (Charleston Gray)mewcgB442
MELO3C006618Watermelon (97103) v1mewmB486
MELO3C006618Watermelon (97103) v1mewmB461
MELO3C006618Cucurbita pepo (Zucchini)cpemeB140
MELO3C006618Cucurbita pepo (Zucchini)cpemeB144
MELO3C006618Cucurbita pepo (Zucchini)cpemeB314
MELO3C006618Cucurbita pepo (Zucchini)cpemeB585
MELO3C006618Cucurbita pepo (Zucchini)cpemeB813
MELO3C006618Bottle gourd (USVL1VR-Ls)lsimeB029
MELO3C006618Bottle gourd (USVL1VR-Ls)lsimeB369
MELO3C006618Cucumber (Gy14) v2cgybmeB200
MELO3C006618Silver-seed gourdcarmeB0332
MELO3C006618Silver-seed gourdcarmeB0610
MELO3C006618Silver-seed gourdcarmeB0828
MELO3C006618Cucumber (Chinese Long) v3cucmeB236
MELO3C006618Cucumber (Chinese Long) v3cucmeB510
MELO3C006618Watermelon (97103) v2mewmbB434
MELO3C006618Watermelon (97103) v2mewmbB448
MELO3C006618Wax gourdmewgoB521
MELO3C006618Wax gourdmewgoB529
MELO3C006618Melon (DHL92) v3.5.1memeB051
MELO3C006618Cucumber (Gy14) v1cgymeB307
MELO3C006618Cucumber (Gy14) v1cgymeB439
MELO3C006618Cucumber (Gy14) v1cgymeB595