MELO3C006610 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTGGTTGTGGGAAGTTAGAAGTGATTCTTAGGGTTTTGGGATTTTTGTTGAGTTTGGTGGCAGCCATTGTTGTGGGAGTTGACAAAGAAACAAAGGTTGTTCCCGTTACTATCTCCTCCAATCTTCCTCCTTTTCCGATTGTCGTGGTTGCTAAATGGCGTTATCTGTCTGCTTTTGTGTAA ATGAGTGGTTGTGGGAAGTTAGAAGTGATTCTTAGGGTTTTGGGATTTTTGTTGAGTTTGGTGGCAGCCATTGTTGTGGGAGTTGACAAAGAAACAAAGGTTGTTCCCGTTACTATCTCCTCCAATCTTCCTCCTTTTCCGATTGTCGTGGTTGCTAAATGGCGTTATCTGTCTGCTTTTGTGTAA ATGAGTGGTTGTGGGAAGTTAGAAGTGATTCTTAGGGTTTTGGGATTTTTGTTGAGTTTGGTGGCAGCCATTGTTGTGGGAGTTGACAAAGAAACAAAGGTTGTTCCCGTTACTATCTCCTCCAATCTTCCTCCTTTTCCGATTGTCGTGGTTGCTAAATGGCGTTATCTGTCTGCTTTTGTGTAA MSGCGKLEVILRVLGFLLSLVAAIVVGVDKETKVVPVTISSNLPPFPIVVVAKWRYLSAFV*
BLAST of MELO3C006610 vs. Swiss-Prot
Match: CSPL5_VITVI (CASP-like protein 1E2 OS=Vitis vinifera GN=VIT_05s0020g01820 PE=2 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.1e-10 Identity = 33/60 (55.00%), Postives = 43/60 (71.67%), Query Frame = 1
BLAST of MELO3C006610 vs. Swiss-Prot
Match: CSPL8_VITVI (CASP-like protein 1E1 OS=Vitis vinifera GN=VIT_07s0104g01350 PE=2 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.1e-10 Identity = 29/54 (53.70%), Postives = 39/54 (72.22%), Query Frame = 1
BLAST of MELO3C006610 vs. Swiss-Prot
Match: CSPL7_POPTR (CASP-like protein 1E1 OS=Populus trichocarpa GN=POPTRDRAFT_820934 PE=3 SV=2) HSP 1 Score: 66.2 bits (160), Expect = 1.4e-10 Identity = 32/58 (55.17%), Postives = 39/58 (67.24%), Query Frame = 1
BLAST of MELO3C006610 vs. Swiss-Prot
Match: CSPL5_SOYBN (CASP-like protein 1E2 OS=Glycine max PE=2 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 2.4e-10 Identity = 29/57 (50.88%), Postives = 41/57 (71.93%), Query Frame = 1
BLAST of MELO3C006610 vs. Swiss-Prot
Match: CSPL6_SOYBN (CASP-like protein 1E1 OS=Glycine max PE=2 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 3.1e-10 Identity = 28/57 (49.12%), Postives = 41/57 (71.93%), Query Frame = 1
BLAST of MELO3C006610 vs. TrEMBL
Match: A0A0A0L8Y1_CUCSA (CASP-like protein OS=Cucumis sativus GN=Csa_3G151500 PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 2.2e-23 Identity = 57/61 (93.44%), Postives = 60/61 (98.36%), Query Frame = 1
BLAST of MELO3C006610 vs. TrEMBL
Match: G7JJ31_MEDTR (CASP-like protein OS=Medicago truncatula GN=MTR_4g118810 PE=3 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 3.4e-11 Identity = 34/60 (56.67%), Postives = 45/60 (75.00%), Query Frame = 1
BLAST of MELO3C006610 vs. TrEMBL
Match: A0A0A0LAI6_CUCSA (CASP-like protein OS=Cucumis sativus GN=Csa_3G151490 PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 5.7e-11 Identity = 34/56 (60.71%), Postives = 44/56 (78.57%), Query Frame = 1
BLAST of MELO3C006610 vs. TrEMBL
Match: A0A067K8E8_JATCU (CASP-like protein OS=Jatropha curcas GN=JCGZ_13860 PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 5.7e-11 Identity = 33/54 (61.11%), Postives = 44/54 (81.48%), Query Frame = 1
BLAST of MELO3C006610 vs. TrEMBL
Match: V7BS45_PHAVU (CASP-like protein OS=Phaseolus vulgaris GN=PHAVU_006G161900g PE=3 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 3.7e-10 Identity = 31/63 (49.21%), Postives = 47/63 (74.60%), Query Frame = 1
BLAST of MELO3C006610 vs. TAIR10
Match: AT4G15630.1 (AT4G15630.1 Uncharacterised protein family (UPF0497)) HSP 1 Score: 58.5 bits (140), Expect = 1.6e-09 Identity = 29/55 (52.73%), Postives = 37/55 (67.27%), Query Frame = 1
BLAST of MELO3C006610 vs. TAIR10
Match: AT4G15620.1 (AT4G15620.1 Uncharacterised protein family (UPF0497)) HSP 1 Score: 54.7 bits (130), Expect = 2.4e-08 Identity = 27/55 (49.09%), Postives = 35/55 (63.64%), Query Frame = 1
BLAST of MELO3C006610 vs. NCBI nr
Match: gi|659076673|ref|XP_008438806.1| (PREDICTED: CASP-like protein 6 [Cucumis melo]) HSP 1 Score: 120.2 bits (300), Expect = 1.3e-24 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 1
BLAST of MELO3C006610 vs. NCBI nr
Match: gi|449432805|ref|XP_004134189.1| (PREDICTED: CASP-like protein 1E1 [Cucumis sativus]) HSP 1 Score: 115.5 bits (288), Expect = 3.2e-23 Identity = 57/61 (93.44%), Postives = 60/61 (98.36%), Query Frame = 1
BLAST of MELO3C006610 vs. NCBI nr
Match: gi|659076671|ref|XP_008438805.1| (PREDICTED: CASP-like protein 5 [Cucumis melo]) HSP 1 Score: 76.6 bits (187), Expect = 1.7e-11 Identity = 35/56 (62.50%), Postives = 45/56 (80.36%), Query Frame = 1
BLAST of MELO3C006610 vs. NCBI nr
Match: gi|357478597|ref|XP_003609584.1| (plant integral membrane protein [Medicago truncatula]) HSP 1 Score: 75.1 bits (183), Expect = 4.8e-11 Identity = 34/60 (56.67%), Postives = 45/60 (75.00%), Query Frame = 1
BLAST of MELO3C006610 vs. NCBI nr
Match: gi|802688477|ref|XP_012082669.1| (PREDICTED: CASP-like protein 1E1 [Jatropha curcas]) HSP 1 Score: 74.3 bits (181), Expect = 8.2e-11 Identity = 33/54 (61.11%), Postives = 44/54 (81.48%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |