MELO3C006465 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.AAACCCAAACAATCTCAAAATCTCGACATTTATATAAATCCAACATCTCCCTAACCAATAAGCTCATCATACACAGCTTTAACATATCTTTCGTTATTAAAATTATTCAAACCAAAGATGTCCGACGATTGCAAAGGTACGAAAAAGTTGTCTTGTCGTTTCATAGTTGTTTTTAGTTATTTGTGTATGTATATTTTGAAGATCAAAGGTGAGATAATTTTAATTTTTTTCCCTACTCAAATGGTTAATTAATTAATTGTTACAGGCAAGAGCTCTTGGCCGGAGTTGGTTGGAGTTTCGGGCAACATAGCTGAAAAGATTATTGAAAAAGAGAACCATTATGTTAATGCGATCATTGTTGAGCAAGGAAAATTTGTTACACAAGATTTCAGGTGTGATAGGGTTTGGGTTTGGGTCGATAAGTACACCCGCATTGTTGTTAAGACTCCCATAATTGGTTAAGTTATATATTAGTGAGACATGTGTATGTATATGTCTCCGAATTAAACGTTAAATGTTATGAAAATAAGAAAGGAAAATGTAGTTTCCTTATGTTTGTGTTATGTAATCTAAAATAAAGTTTATGTGCATGGCCTACGTATGAATTTGTTTTTGTAATCTATTATATTCCTTTGACTTTGTTGCATCGGTTGCTCTTTTGTCAACACCTTTTTTTAATGAAGATTTGAATTTTGTTGTACAAGCT AAACCCAAACAATCTCAAAATCTCGACATTTATATAAATCCAACATCTCCCTAACCAATAAGCTCATCATACACAGCTTTAACATATCTTTCGTTATTAAAATTATTCAAACCAAAGATGTCCGACGATTGCAAAGGCAAGAGCTCTTGGCCGGAGTTGGTTGGAGTTTCGGGCAACATAGCTGAAAAGATTATTGAAAAAGAGAACCATTATGTTAATGCGATCATTGTTGAGCAAGGAAAATTTGTTACACAAGATTTCAGGTGTGATAGGGTTTGGGTTTGGGTCGATAAGTACACCCGCATTGTTGTTAAGACTCCCATAATTGGTTAAGTTATATATTAGTGAGACATGTGTATGTATATGTCTCCGAATTAAACGTTAAATGTTATGAAAATAAGAAAGGAAAATGTAGTTTCCTTATGTTTGTGTTATGTAATCTAAAATAAAGTTTATGTGCATGGCCTACGTATGAATTTGTTTTTGTAATCTATTATATTCCTTTGACTTTGTTGCATCGGTTGCTCTTTTGTCAACACCTTTTTTTAATGAAGATTTGAATTTTGTTGTACAAGCT ATGTCCGACGATTGCAAAGGCAAGAGCTCTTGGCCGGAGTTGGTTGGAGTTTCGGGCAACATAGCTGAAAAGATTATTGAAAAAGAGAACCATTATGTTAATGCGATCATTGTTGAGCAAGGAAAATTTGTTACACAAGATTTCAGGTGTGATAGGGTTTGGGTTTGGGTCGATAAGTACACCCGCATTGTTGTTAAGACTCCCATAATTGGTTAA MSDDCKGKSSWPELVGVSGNIAEKIIEKENHYVNAIIVEQGKFVTQDFRCDRVWVWVDKYTRIVVKTPIIG*
BLAST of MELO3C006465 vs. Swiss-Prot
Match: ITH5_CUCMA (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima PE=1 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.4e-14 Identity = 38/67 (56.72%), Postives = 49/67 (73.13%), Query Frame = 1
BLAST of MELO3C006465 vs. Swiss-Prot
Match: ICI_LINUS (Proteinase inhibitor OS=Linum usitatissimum PE=1 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 2.7e-13 Identity = 35/69 (50.72%), Postives = 49/69 (71.01%), Query Frame = 1
BLAST of MELO3C006465 vs. Swiss-Prot
Match: BGIA_MOMCH (Glu S.griseus protease inhibitor OS=Momordica charantia PE=1 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.0e-12 Identity = 37/67 (55.22%), Postives = 44/67 (65.67%), Query Frame = 1
BLAST of MELO3C006465 vs. Swiss-Prot
Match: ATSI_AMACA (Trypsin/subtilisin inhibitor OS=Amaranthus caudatus PE=1 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.1e-11 Identity = 35/65 (53.85%), Postives = 41/65 (63.08%), Query Frame = 1
BLAST of MELO3C006465 vs. Swiss-Prot
Match: HPI_HEVBR (Protease inhibitor HPI OS=Hevea brasiliensis GN=PI1 PE=1 SV=2) HSP 1 Score: 68.6 bits (166), Expect = 3.3e-11 Identity = 35/71 (49.30%), Postives = 47/71 (66.20%), Query Frame = 1
BLAST of MELO3C006465 vs. TrEMBL
Match: A0A0A0L4J0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G142970 PE=4 SV=1) HSP 1 Score: 139.8 bits (351), Expect = 1.3e-30 Identity = 66/71 (92.96%), Postives = 68/71 (95.77%), Query Frame = 1
BLAST of MELO3C006465 vs. TrEMBL
Match: A0A0A0L795_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G142960 PE=4 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 1.9e-21 Identity = 51/71 (71.83%), Postives = 57/71 (80.28%), Query Frame = 1
BLAST of MELO3C006465 vs. TrEMBL
Match: B1ACD2_SOYBN (Putative protease inhibitor OS=Glycine max GN=GLYMA_10G184700 PE=2 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.5e-18 Identity = 48/71 (67.61%), Postives = 54/71 (76.06%), Query Frame = 1
BLAST of MELO3C006465 vs. TrEMBL
Match: G7KCZ8_MEDTR (Inhibitor of trypsin and hageman factor-like protein OS=Medicago truncatula GN=MTR_5g090250 PE=4 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.5e-18 Identity = 49/71 (69.01%), Postives = 55/71 (77.46%), Query Frame = 1
BLAST of MELO3C006465 vs. TrEMBL
Match: A0A0B2P035_GLYSO (Inhibitor of trypsin and hageman factor OS=Glycine soja GN=glysoja_000750 PE=4 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.5e-18 Identity = 48/71 (67.61%), Postives = 54/71 (76.06%), Query Frame = 1
BLAST of MELO3C006465 vs. TAIR10
Match: AT2G38870.1 (AT2G38870.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 77.0 bits (188), Expect = 5.2e-15 Identity = 40/71 (56.34%), Postives = 47/71 (66.20%), Query Frame = 1
BLAST of MELO3C006465 vs. TAIR10
Match: AT2G38900.2 (AT2G38900.2 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 70.5 bits (171), Expect = 4.9e-13 Identity = 32/65 (49.23%), Postives = 43/65 (66.15%), Query Frame = 1
BLAST of MELO3C006465 vs. TAIR10
Match: AT5G43580.1 (AT5G43580.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 66.6 bits (161), Expect = 7.0e-12 Identity = 33/65 (50.77%), Postives = 43/65 (66.15%), Query Frame = 1
BLAST of MELO3C006465 vs. TAIR10
Match: AT5G43570.1 (AT5G43570.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 52.4 bits (124), Expect = 1.4e-07 Identity = 33/75 (44.00%), Postives = 41/75 (54.67%), Query Frame = 1
BLAST of MELO3C006465 vs. TAIR10
Match: AT3G46860.1 (AT3G46860.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 49.7 bits (117), Expect = 8.9e-07 Identity = 26/64 (40.62%), Postives = 39/64 (60.94%), Query Frame = 1
BLAST of MELO3C006465 vs. NCBI nr
Match: gi|700201772|gb|KGN56905.1| (hypothetical protein Csa_3G142970 [Cucumis sativus]) HSP 1 Score: 139.8 bits (351), Expect = 1.9e-30 Identity = 66/71 (92.96%), Postives = 68/71 (95.77%), Query Frame = 1
BLAST of MELO3C006465 vs. NCBI nr
Match: gi|449432606|ref|XP_004134090.1| (PREDICTED: glu S.griseus protease inhibitor-like [Cucumis sativus]) HSP 1 Score: 109.4 bits (272), Expect = 2.7e-21 Identity = 51/71 (71.83%), Postives = 57/71 (80.28%), Query Frame = 1
BLAST of MELO3C006465 vs. NCBI nr
Match: gi|659076233|ref|XP_008438570.1| (PREDICTED: glu S.griseus protease inhibitor-like [Cucumis melo]) HSP 1 Score: 104.4 bits (259), Expect = 8.6e-20 Identity = 49/71 (69.01%), Postives = 55/71 (77.46%), Query Frame = 1
BLAST of MELO3C006465 vs. NCBI nr
Match: gi|351727373|ref|NP_001238694.1| (protease inhibitor-like [Glycine max]) HSP 1 Score: 99.8 bits (247), Expect = 2.1e-18 Identity = 48/71 (67.61%), Postives = 54/71 (76.06%), Query Frame = 1
BLAST of MELO3C006465 vs. NCBI nr
Match: gi|357494051|ref|XP_003617314.1| (inhibitor of trypsin and hageman factor-like protein [Medicago truncatula]) HSP 1 Score: 99.8 bits (247), Expect = 2.1e-18 Identity = 49/71 (69.01%), Postives = 55/71 (77.46%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |