MELO3C006464 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATCACAAGACTTTCCCAAATAGATAAAGAGAAAAAAAAAGTTCCCAAAGAAAAATCTCGCGAAAGATGTCTACAACATGCAAAGGTACGTGATGAGTAAATAATTCCATTAATTACTATCAAGTGTAGATTTGAAAGAGACGAATTTTCAAAATAATTGTTTTTGTTTTTAAAGCATTCAAGTATTTATATGAAATTTAGAATGAAAATTAAAACAAACACATAACTTCAAATAGCTGAAAACTGAAGGCAAAATCTCTAAAACGTTGCTTAGTAATTATTTGATTTTTTATTTTTGAAAAGTATGTATATTGACACTTATTTTACCTCTATACTTTTTGTTTTGTGCTAGACTTTGGAAAAAATTAACTTCTAAAAACATTTTAGTACACTCATAAATATAACAATAATATCAATATCATACAAAAAGGAACCGTACGTATAACAAAATATTATATTAAACCTTTAGAATCTATATCATTAAAACACAGACAGGAAAACATTTTGGATTATAATTTTTAGAATCTAAAATATAAACATTTGGGTTTTGTGTGTGTTTGAAATGTTTAGGGAAGAGTTCATGGCCGGAGTTGGTTGGTAAAGCAGGAAAAGAAGCAGAGAAGACAATTGAGAGAGAGAATCCATTGGTGGATGCTATTATTGTTGATGAAGGTTCAGTGGTGATTCAAGACTTTAGGTGCGACAGGGTTTGGGTTTGGGTGGATCCTAAGACAGCCATTGTCACCAGGACTCCCTTCATTGGTTAAAATTGAATATATGTTTTAAATTATATGTGTTATTTCAATATTATTATTCAAATGCCAATTCATGTTTGTTCCTACCACATGAATAATATTATTTCAATAAGGCATTTATGATCTTTTTTCTTTTTTCTTTTTCCTTTCAAAGATGTCTGATATAATGTAATACTTGTGTTTGCCGTAATAAAAATATTTGTTATGTGTTATGTTACTTTCCTTTACTATT ATCACAAGACTTTCCCAAATAGATAAAGAGAAAAAAAAAGTTCCCAAAGAAAAATCTCGCGAAAGATGTCTACAACATGCAAAGGGAAGAGTTCATGGCCGGAGTTGGTTGGTAAAGCAGGAAAAGAAGCAGAGAAGACAATTGAGAGAGAGAATCCATTGGTGGATGCTATTATTGTTGATGAAGGTTCAGTGGTGATTCAAGACTTTAGGTGCGACAGGGTTTGGGTTTGGGTGGATCCTAAGACAGCCATTGTCACCAGGACTCCCTTCATTGGTTAAAATTGAATATATGTTTTAAATTATATGTGTTATTTCAATATTATTATTCAAATGCCAATTCATGTTTGTTCCTACCACATGAATAATATTATTTCAATAAGGCATTTATGATCTTTTTTCTTTTTTCTTTTTCCTTTCAAAGATGTCTGATATAATGTAATACTTGTGTTTGCCGTAATAAAAATATTTGTTATGTGTTATGTTACTTTCCTTTACTATT ATGTCTACAACATGCAAAGGGAAGAGTTCATGGCCGGAGTTGGTTGGTAAAGCAGGAAAAGAAGCAGAGAAGACAATTGAGAGAGAGAATCCATTGGTGGATGCTATTATTGTTGATGAAGGTTCAGTGGTGATTCAAGACTTTAGGTGCGACAGGGTTTGGGTTTGGGTGGATCCTAAGACAGCCATTGTCACCAGGACTCCCTTCATTGGTTAA MSTTCKGKSSWPELVGKAGKEAEKTIERENPLVDAIIVDEGSVVIQDFRCDRVWVWVDPKTAIVTRTPFIG*
BLAST of MELO3C006464 vs. Swiss-Prot
Match: BGIA_MOMCH (Glu S.griseus protease inhibitor OS=Momordica charantia PE=1 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 4.1e-14 Identity = 40/67 (59.70%), Postives = 43/67 (64.18%), Query Frame = 1
BLAST of MELO3C006464 vs. Swiss-Prot
Match: ICI_LINUS (Proteinase inhibitor OS=Linum usitatissimum PE=1 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 4.1e-14 Identity = 38/69 (55.07%), Postives = 46/69 (66.67%), Query Frame = 1
BLAST of MELO3C006464 vs. Swiss-Prot
Match: ITH5_CUCMA (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima PE=1 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 2.1e-13 Identity = 36/69 (52.17%), Postives = 48/69 (69.57%), Query Frame = 1
BLAST of MELO3C006464 vs. Swiss-Prot
Match: ATSI_AMACA (Trypsin/subtilisin inhibitor OS=Amaranthus caudatus PE=1 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 7.8e-13 Identity = 37/64 (57.81%), Postives = 41/64 (64.06%), Query Frame = 1
BLAST of MELO3C006464 vs. Swiss-Prot
Match: ITI_FAGTA (Trypsin inhibitor OS=Fagopyrum tataricum PE=1 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 1.5e-08 Identity = 32/72 (44.44%), Postives = 41/72 (56.94%), Query Frame = 1
BLAST of MELO3C006464 vs. TrEMBL
Match: A0A0A0L795_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G142960 PE=4 SV=1) HSP 1 Score: 137.5 bits (345), Expect = 6.4e-30 Identity = 64/71 (90.14%), Postives = 67/71 (94.37%), Query Frame = 1
BLAST of MELO3C006464 vs. TrEMBL
Match: B1ACD2_SOYBN (Putative protease inhibitor OS=Glycine max GN=GLYMA_10G184700 PE=2 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 2.7e-20 Identity = 52/71 (73.24%), Postives = 55/71 (77.46%), Query Frame = 1
BLAST of MELO3C006464 vs. TrEMBL
Match: A0A0B2P035_GLYSO (Inhibitor of trypsin and hageman factor OS=Glycine soja GN=glysoja_000750 PE=4 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 2.7e-20 Identity = 52/71 (73.24%), Postives = 55/71 (77.46%), Query Frame = 1
BLAST of MELO3C006464 vs. TrEMBL
Match: G7I4R6_MEDTR (Inhibitor of trypsin and hageman factor-like protein OS=Medicago truncatula GN=MTR_1g075410 PE=4 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 7.8e-20 Identity = 52/67 (77.61%), Postives = 54/67 (80.60%), Query Frame = 1
BLAST of MELO3C006464 vs. TrEMBL
Match: A0A0A0L4J0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G142970 PE=4 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.0e-19 Identity = 49/71 (69.01%), Postives = 55/71 (77.46%), Query Frame = 1
BLAST of MELO3C006464 vs. TAIR10
Match: AT2G38870.1 (AT2G38870.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 72.8 bits (177), Expect = 9.8e-14 Identity = 39/71 (54.93%), Postives = 44/71 (61.97%), Query Frame = 1
BLAST of MELO3C006464 vs. TAIR10
Match: AT5G43580.1 (AT5G43580.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 72.4 bits (176), Expect = 1.3e-13 Identity = 36/73 (49.32%), Postives = 51/73 (69.86%), Query Frame = 1
BLAST of MELO3C006464 vs. TAIR10
Match: AT5G43570.1 (AT5G43570.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 63.5 bits (153), Expect = 5.9e-11 Identity = 36/74 (48.65%), Postives = 46/74 (62.16%), Query Frame = 1
BLAST of MELO3C006464 vs. TAIR10
Match: AT3G46860.1 (AT3G46860.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 55.8 bits (133), Expect = 1.2e-08 Identity = 31/64 (48.44%), Postives = 39/64 (60.94%), Query Frame = 1
BLAST of MELO3C006464 vs. NCBI nr
Match: gi|659076233|ref|XP_008438570.1| (PREDICTED: glu S.griseus protease inhibitor-like [Cucumis melo]) HSP 1 Score: 149.8 bits (377), Expect = 1.8e-33 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 1
BLAST of MELO3C006464 vs. NCBI nr
Match: gi|449432606|ref|XP_004134090.1| (PREDICTED: glu S.griseus protease inhibitor-like [Cucumis sativus]) HSP 1 Score: 137.5 bits (345), Expect = 9.2e-30 Identity = 64/71 (90.14%), Postives = 67/71 (94.37%), Query Frame = 1
BLAST of MELO3C006464 vs. NCBI nr
Match: gi|351727373|ref|NP_001238694.1| (protease inhibitor-like [Glycine max]) HSP 1 Score: 105.5 bits (262), Expect = 3.9e-20 Identity = 52/71 (73.24%), Postives = 55/71 (77.46%), Query Frame = 1
BLAST of MELO3C006464 vs. NCBI nr
Match: gi|357441047|ref|XP_003590801.1| (inhibitor of trypsin and hageman factor-like protein [Medicago truncatula]) HSP 1 Score: 104.0 bits (258), Expect = 1.1e-19 Identity = 52/67 (77.61%), Postives = 54/67 (80.60%), Query Frame = 1
BLAST of MELO3C006464 vs. NCBI nr
Match: gi|700201772|gb|KGN56905.1| (hypothetical protein Csa_3G142970 [Cucumis sativus]) HSP 1 Score: 103.6 bits (257), Expect = 1.5e-19 Identity = 49/71 (69.01%), Postives = 55/71 (77.46%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |