MELO3C006437 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAGTTGATTTCAAATGACAAATTTGTAAGCTCGGTGCATAGAGTGGTGGCTAATCGTGAGGGTCCAAGAATATCAGTGGCAAGTGCCTTCAGCACCGGCACTATACCAACCTCCAAAGTTTATGGACCCATCAAGCAATTGTTGTCCCAACAAAATCCTCCCAAGTATAGACAAATCACTGTTAAGAGAGTACCGTATCTACTTTGCTAA ATGCAGTTGATTTCAAATGACAAATTTGTAAGCTCGGTGCATAGAGTGGTGGCTAATCGTGAGGGTCCAAGAATATCAGTGGCAAGTGCCTTCAGCACCGGCACTATACCAACCTCCAAAGTTTATGGACCCATCAAGCAATTGTTGTCCCAACAAAATCCTCCCAAGTATAGACAAATCACTGTTAAGAGAGTACCGTATCTACTTTGCTAA ATGCAGTTGATTTCAAATGACAAATTTGTAAGCTCGGTGCATAGAGTGGTGGCTAATCGTGAGGGTCCAAGAATATCAGTGGCAAGTGCCTTCAGCACCGGCACTATACCAACCTCCAAAGTTTATGGACCCATCAAGCAATTGTTGTCCCAACAAAATCCTCCCAAGTATAGACAAATCACTGTTAAGAGAGTACCGTATCTACTTTGCTAA MQLISNDKFVSSVHRVVANREGPRISVASAFSTGTIPTSKVYGPIKQLLSQQNPPKYRQITVKRVPYLLC*
BLAST of MELO3C006437 vs. Swiss-Prot
Match: ACH12_ARATH (1-aminocyclopropane-1-carboxylate oxidase homolog 12 OS=Arabidopsis thaliana GN=At5g59540 PE=2 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 5.5e-19 Identity = 43/63 (68.25%), Postives = 53/63 (84.13%), Query Frame = 1
BLAST of MELO3C006437 vs. Swiss-Prot
Match: ACCH9_ARATH (1-aminocyclopropane-1-carboxylate oxidase homolog 9 OS=Arabidopsis thaliana GN=At5g43440 PE=2 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 5.2e-17 Identity = 42/62 (67.74%), Postives = 47/62 (75.81%), Query Frame = 1
BLAST of MELO3C006437 vs. Swiss-Prot
Match: ACCH7_ARATH (1-aminocyclopropane-1-carboxylate oxidase homolog 7 OS=Arabidopsis thaliana GN=At1g04380 PE=1 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 4.4e-16 Identity = 38/62 (61.29%), Postives = 47/62 (75.81%), Query Frame = 1
BLAST of MELO3C006437 vs. Swiss-Prot
Match: ACH11_ARATH (1-aminocyclopropane-1-carboxylate oxidase homolog 11 OS=Arabidopsis thaliana GN=At5g59530 PE=2 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 1.7e-15 Identity = 38/63 (60.32%), Postives = 48/63 (76.19%), Query Frame = 1
BLAST of MELO3C006437 vs. Swiss-Prot
Match: ACCH1_ARATH (1-aminocyclopropane-1-carboxylate oxidase homolog 1 OS=Arabidopsis thaliana GN=At1g06620 PE=2 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 2.4e-14 Identity = 36/62 (58.06%), Postives = 46/62 (74.19%), Query Frame = 1
BLAST of MELO3C006437 vs. TrEMBL
Match: A0A0A0L9W1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G135680 PE=3 SV=1) HSP 1 Score: 123.6 bits (309), Expect = 9.4e-26 Identity = 61/63 (96.83%), Postives = 63/63 (100.00%), Query Frame = 1
BLAST of MELO3C006437 vs. TrEMBL
Match: Q948K9_CUCME (CmE8 protein OS=Cucumis melo GN=CmE8 PE=3 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 2.7e-20 Identity = 48/63 (76.19%), Postives = 60/63 (95.24%), Query Frame = 1
BLAST of MELO3C006437 vs. TrEMBL
Match: A0A0A0L554_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G135700 PE=3 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 3.5e-20 Identity = 47/63 (74.60%), Postives = 60/63 (95.24%), Query Frame = 1
BLAST of MELO3C006437 vs. TrEMBL
Match: A0A0D2R9D8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G048800 PE=3 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 4.2e-18 Identity = 46/63 (73.02%), Postives = 55/63 (87.30%), Query Frame = 1
BLAST of MELO3C006437 vs. TrEMBL
Match: A0A0A0L8B5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G135690 PE=3 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 2.1e-17 Identity = 44/63 (69.84%), Postives = 55/63 (87.30%), Query Frame = 1
BLAST of MELO3C006437 vs. TAIR10
Match: AT5G59540.1 (AT5G59540.1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein) HSP 1 Score: 94.4 bits (233), Expect = 3.1e-20 Identity = 43/63 (68.25%), Postives = 53/63 (84.13%), Query Frame = 1
BLAST of MELO3C006437 vs. TAIR10
Match: AT5G43440.1 (AT5G43440.1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein) HSP 1 Score: 87.8 bits (216), Expect = 2.9e-18 Identity = 42/62 (67.74%), Postives = 47/62 (75.81%), Query Frame = 1
BLAST of MELO3C006437 vs. TAIR10
Match: AT1G04380.1 (AT1G04380.1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein) HSP 1 Score: 84.7 bits (208), Expect = 2.5e-17 Identity = 38/62 (61.29%), Postives = 47/62 (75.81%), Query Frame = 1
BLAST of MELO3C006437 vs. TAIR10
Match: AT5G59530.1 (AT5G59530.1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein) HSP 1 Score: 82.8 bits (203), Expect = 9.3e-17 Identity = 38/63 (60.32%), Postives = 48/63 (76.19%), Query Frame = 1
BLAST of MELO3C006437 vs. TAIR10
Match: AT1G04350.1 (AT1G04350.1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein) HSP 1 Score: 79.0 bits (193), Expect = 1.3e-15 Identity = 41/64 (64.06%), Postives = 47/64 (73.44%), Query Frame = 1
BLAST of MELO3C006437 vs. NCBI nr
Match: gi|778678235|ref|XP_004134072.2| (PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog [Cucumis sativus]) HSP 1 Score: 123.6 bits (309), Expect = 1.4e-25 Identity = 61/63 (96.83%), Postives = 63/63 (100.00%), Query Frame = 1
BLAST of MELO3C006437 vs. NCBI nr
Match: gi|15721876|dbj|BAB68392.1| (CmE8 [Cucumis melo]) HSP 1 Score: 105.5 bits (262), Expect = 3.8e-20 Identity = 48/63 (76.19%), Postives = 60/63 (95.24%), Query Frame = 1
BLAST of MELO3C006437 vs. NCBI nr
Match: gi|659076175|ref|XP_008438542.1| (PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclopropane-1-carboxylate oxidase homolog 1-like [Cucumis melo]) HSP 1 Score: 105.5 bits (262), Expect = 3.8e-20 Identity = 48/63 (76.19%), Postives = 60/63 (95.24%), Query Frame = 1
BLAST of MELO3C006437 vs. NCBI nr
Match: gi|449432574|ref|XP_004134074.1| (PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 1 [Cucumis sativus]) HSP 1 Score: 105.1 bits (261), Expect = 5.0e-20 Identity = 47/63 (74.60%), Postives = 60/63 (95.24%), Query Frame = 1
BLAST of MELO3C006437 vs. NCBI nr
Match: gi|1009140976|ref|XP_015887942.1| (PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 3-like [Ziziphus jujuba]) HSP 1 Score: 100.9 bits (250), Expect = 9.4e-19 Identity = 47/63 (74.60%), Postives = 56/63 (88.89%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |