MELO3C006349 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGAAGTGAAACTCCATGGGATGTGGGCAAGTCCTTTTGTTTGCAGAGTGAAATGGGGTTTGGAGCTTAAGGGCATACCATATGAATACGTTGAAGAAGATATCTCTAACAAAAGTCCATCGTTGCTTCACTACAATCCTCTTTACAAGAAGGTTCCTGTGCTTGTTCATGGTGCAAAACCCGTGTGTGAGTCCATCATCATCCTCGAATACATCGATGAAATATGGCCTCAATATCCTCTCTTTCCTATCGATCCCTTCGATAGAGCAACCACTCGCTTTTGGATCAAATATGCTGATAATAAGGTCCTTTAA ATGGAAGAAGTGAAACTCCATGGGATGTGGGCAAGTCCTTTTGTTTGCAGAGTGAAATGGGGTTTGGAGCTTAAGGGCATACCATATGAATACGTTGAAGAAGATATCTCTAACAAAAGTCCATCGTTGCTTCACTACAATCCTCTTTACAAGAAGGTTCCTGTGCTTGTTCATGGTGCAAAACCCGTGTGTGAGTCCATCATCATCCTCGAATACATCGATGAAATATGGCCTCAATATCCTCTCTTTCCTATCGATCCCTTCGATAGAGCAACCACTCGCTTTTGGATCAAATATGCTGATAATAAGGTCCTTTAA ATGGAAGAAGTGAAACTCCATGGGATGTGGGCAAGTCCTTTTGTTTGCAGAGTGAAATGGGGTTTGGAGCTTAAGGGCATACCATATGAATACGTTGAAGAAGATATCTCTAACAAAAGTCCATCGTTGCTTCACTACAATCCTCTTTACAAGAAGGTTCCTGTGCTTGTTCATGGTGCAAAACCCGTGTGTGAGTCCATCATCATCCTCGAATACATCGATGAAATATGGCCTCAATATCCTCTCTTTCCTATCGATCCCTTCGATAGAGCAACCACTCGCTTTTGGATCAAATATGCTGATAATAAGGTCCTTTAA MEEVKLHGMWASPFVCRVKWGLELKGIPYEYVEEDISNKSPSLLHYNPLYKKVPVLVHGAKPVCESIIILEYIDEIWPQYPLFPIDPFDRATTRFWIKYADNKVL*
BLAST of MELO3C006349 vs. Swiss-Prot
Match: GST23_MAIZE (Glutathione transferase GST 23 OS=Zea mays PE=2 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 6.5e-32 Identity = 62/101 (61.39%), Postives = 77/101 (76.24%), Query Frame = 1
BLAST of MELO3C006349 vs. Swiss-Prot
Match: GSTU5_ARATH (Glutathione S-transferase U5 OS=Arabidopsis thaliana GN=GSTU5 PE=2 SV=1) HSP 1 Score: 136.3 bits (342), Expect = 1.9e-31 Identity = 63/104 (60.58%), Postives = 77/104 (74.04%), Query Frame = 1
BLAST of MELO3C006349 vs. Swiss-Prot
Match: GSTX2_TOBAC (Probable glutathione S-transferase OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 7.2e-31 Identity = 62/104 (59.62%), Postives = 74/104 (71.15%), Query Frame = 1
BLAST of MELO3C006349 vs. Swiss-Prot
Match: GSTU1_ARATH (Glutathione S-transferase U1 OS=Arabidopsis thaliana GN=GSTU1 PE=2 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 1.6e-30 Identity = 60/104 (57.69%), Postives = 76/104 (73.08%), Query Frame = 1
BLAST of MELO3C006349 vs. Swiss-Prot
Match: GSTU7_ARATH (Glutathione S-transferase U7 OS=Arabidopsis thaliana GN=GSTU7 PE=2 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 6.1e-30 Identity = 57/103 (55.34%), Postives = 74/103 (71.84%), Query Frame = 1
BLAST of MELO3C006349 vs. TrEMBL
Match: A0A0A0L6W3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G133350 PE=3 SV=1) HSP 1 Score: 203.8 bits (517), Expect = 1.1e-49 Identity = 92/104 (88.46%), Postives = 98/104 (94.23%), Query Frame = 1
BLAST of MELO3C006349 vs. TrEMBL
Match: Q8H9E5_CUCMA (Glutathione S-transferase OS=Cucurbita maxima GN=Pugc PE=2 SV=1) HSP 1 Score: 173.3 bits (438), Expect = 1.6e-40 Identity = 76/103 (73.79%), Postives = 88/103 (85.44%), Query Frame = 1
BLAST of MELO3C006349 vs. TrEMBL
Match: A0A0A0L6W9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G133890 PE=4 SV=1) HSP 1 Score: 168.7 bits (426), Expect = 3.8e-39 Identity = 73/102 (71.57%), Postives = 86/102 (84.31%), Query Frame = 1
BLAST of MELO3C006349 vs. TrEMBL
Match: M5XN46_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa021702mg PE=3 SV=1) HSP 1 Score: 164.5 bits (415), Expect = 7.2e-38 Identity = 69/105 (65.71%), Postives = 88/105 (83.81%), Query Frame = 1
BLAST of MELO3C006349 vs. TrEMBL
Match: A0A067EXR5_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g023929mg PE=4 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 1.6e-37 Identity = 72/105 (68.57%), Postives = 89/105 (84.76%), Query Frame = 1
BLAST of MELO3C006349 vs. TAIR10
Match: AT2G29450.1 (AT2G29450.1 glutathione S-transferase tau 5) HSP 1 Score: 136.3 bits (342), Expect = 1.1e-32 Identity = 63/104 (60.58%), Postives = 77/104 (74.04%), Query Frame = 1
BLAST of MELO3C006349 vs. TAIR10
Match: AT2G29490.1 (AT2G29490.1 glutathione S-transferase TAU 1) HSP 1 Score: 133.3 bits (334), Expect = 9.0e-32 Identity = 60/104 (57.69%), Postives = 76/104 (73.08%), Query Frame = 1
BLAST of MELO3C006349 vs. TAIR10
Match: AT2G29420.1 (AT2G29420.1 glutathione S-transferase tau 7) HSP 1 Score: 131.3 bits (329), Expect = 3.4e-31 Identity = 57/103 (55.34%), Postives = 74/103 (71.84%), Query Frame = 1
BLAST of MELO3C006349 vs. TAIR10
Match: AT2G29460.1 (AT2G29460.1 glutathione S-transferase tau 4) HSP 1 Score: 130.6 bits (327), Expect = 5.8e-31 Identity = 59/103 (57.28%), Postives = 74/103 (71.84%), Query Frame = 1
BLAST of MELO3C006349 vs. TAIR10
Match: AT3G09270.1 (AT3G09270.1 glutathione S-transferase TAU 8) HSP 1 Score: 129.0 bits (323), Expect = 1.7e-30 Identity = 58/106 (54.72%), Postives = 77/106 (72.64%), Query Frame = 1
BLAST of MELO3C006349 vs. NCBI nr
Match: gi|659075956|ref|XP_008438421.1| (PREDICTED: glutathione transferase GST 23-like [Cucumis melo]) HSP 1 Score: 224.9 bits (572), Expect = 6.4e-56 Identity = 103/104 (99.04%), Postives = 104/104 (100.00%), Query Frame = 1
BLAST of MELO3C006349 vs. NCBI nr
Match: gi|778678003|ref|XP_011650901.1| (PREDICTED: glutathione transferase GST 23-like [Cucumis sativus]) HSP 1 Score: 203.8 bits (517), Expect = 1.5e-49 Identity = 92/104 (88.46%), Postives = 98/104 (94.23%), Query Frame = 1
BLAST of MELO3C006349 vs. NCBI nr
Match: gi|700201651|gb|KGN56784.1| (hypothetical protein Csa_3G133350 [Cucumis sativus]) HSP 1 Score: 203.8 bits (517), Expect = 1.5e-49 Identity = 92/104 (88.46%), Postives = 98/104 (94.23%), Query Frame = 1
BLAST of MELO3C006349 vs. NCBI nr
Match: gi|23978432|dbj|BAC21263.1| (glutathione S-transferase [Cucurbita maxima]) HSP 1 Score: 173.3 bits (438), Expect = 2.2e-40 Identity = 76/103 (73.79%), Postives = 88/103 (85.44%), Query Frame = 1
BLAST of MELO3C006349 vs. NCBI nr
Match: gi|449432478|ref|XP_004134026.1| (PREDICTED: probable glutathione S-transferase [Cucumis sativus]) HSP 1 Score: 168.7 bits (426), Expect = 5.5e-39 Identity = 73/102 (71.57%), Postives = 86/102 (84.31%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |