MELO3C006161 (gene) Melon (DHL92) v3.5.1

NameMELO3C006161
Typegene
OrganismCucumis melo (Melon (DHL92) v3.5.1)
Descriptioncytochrome P450, family 86, subfamily A, polypeptide 8
Locationchr6 : 1406744 .. 1406944 (-)
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGGCGCCGCGGATGAGGAAAACAAGCAAGAGCACGAAAGCGGAGAGAAAGAAGATAACAGCCAAAACGATCAGAAAATATCCTCCGGTACCGCGATCATCTCGGTCATCGCCAAGTATAGCCGAAACAGGCGCCGGTTCTTCATTCACCGCCATTGTCTACGAACACGAGAACGGAGAGAATTGTATATTAGCAGGATAG

mRNA sequence

ATGGCGCCGCGGATGAGGAAAACAAGCAAGAGCACGAAAGCGGAGAGAAAGAAGATAACAGCCAAAACGATCAGAAAATATCCTCCGGTACCGCGATCATCTCGGTCATCGCCAAGTATAGCCGAAACAGGCGCCGGTTCTTCATTCACCGCCATTGTCTACGAACACGAGAACGGAGAGAATTGTATATTAGCAGGATAG

Coding sequence (CDS)

ATGGCGCCGCGGATGAGGAAAACAAGCAAGAGCACGAAAGCGGAGAGAAAGAAGATAACAGCCAAAACGATCAGAAAATATCCTCCGGTACCGCGATCATCTCGGTCATCGCCAAGTATAGCCGAAACAGGCGCCGGTTCTTCATTCACCGCCATTGTCTACGAACACGAGAACGGAGAGAATTGTATATTAGCAGGATAG

Protein sequence

MAPRMRKTSKSTKAERKKITAKTIRKYPPVPRSSRSSPSIAETGAGSSFTAIVYEHENGENCILAG*
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008150 biological_process
cellular_component GO:0005575 cellular_component
molecular_function GO:0003674 molecular_function

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
MELO3C006161T1MELO3C006161T1mRNA


The following gene(s) are orthologous to this gene:

None

The following gene(s) are paralogous to this gene:

None

The following block(s) are covering this gene:
GeneOrganismBlock
MELO3C006161Cucurbita moschata (Rifu)cmomeB230
MELO3C006161Cucurbita moschata (Rifu)cmomeB755
MELO3C006161Cucurbita moschata (Rifu)cmomeB833
MELO3C006161Wild cucumber (PI 183967)cpimeB230
MELO3C006161Wild cucumber (PI 183967)cpimeB401
MELO3C006161Wild cucumber (PI 183967)cpimeB496
MELO3C006161Cucumber (Chinese Long) v2cumeB236
MELO3C006161Cucumber (Chinese Long) v2cumeB494
MELO3C006161Watermelon (Charleston Gray)mewcgB427
MELO3C006161Watermelon (Charleston Gray)mewcgB438
MELO3C006161Watermelon (97103) v1mewmB461
MELO3C006161Watermelon (97103) v1mewmB479
MELO3C006161Watermelon (97103) v1mewmB484
MELO3C006161Cucurbita pepo (Zucchini)cpemeB317
MELO3C006161Cucurbita pepo (Zucchini)cpemeB585
MELO3C006161Cucurbita pepo (Zucchini)cpemeB813
MELO3C006161Bottle gourd (USVL1VR-Ls)lsimeB034
MELO3C006161Bottle gourd (USVL1VR-Ls)lsimeB378
MELO3C006161Cucumber (Gy14) v2cgybmeB200
MELO3C006161Cucumber (Gy14) v2cgybmeB352
MELO3C006161Cucumber (Gy14) v2cgybmeB435
MELO3C006161Silver-seed gourdcarmeB0494
MELO3C006161Silver-seed gourdcarmeB0622
MELO3C006161Cucumber (Chinese Long) v3cucmeB236
MELO3C006161Cucumber (Chinese Long) v3cucmeB412
MELO3C006161Cucumber (Chinese Long) v3cucmeB506
MELO3C006161Watermelon (97103) v2mewmbB422
MELO3C006161Watermelon (97103) v2mewmbB434
MELO3C006161Watermelon (97103) v2mewmbB445
MELO3C006161Wax gourdmewgoB543
MELO3C006161Melon (DHL92) v3.5.1memeB019
MELO3C006161Melon (DHL92) v3.5.1memeB054
MELO3C006161Cucumber (Gy14) v1cgymeB439
MELO3C006161Cucumber (Gy14) v1cgymeB500
MELO3C006161Cucumber (Gy14) v1cgymeB594
MELO3C006161Cucurbita maxima (Rimu)cmameB242
MELO3C006161Cucurbita maxima (Rimu)cmameB763
MELO3C006161Cucurbita maxima (Rimu)cmameB851