MELO3C006037 (gene) Melon (DHL92) v3.5.1

NameMELO3C006037
Typegene
OrganismCucumis melo (Melon (DHL92) v3.5.1)
Description50S ribosomal protein L22, chloroplastic
Locationchr6 : 710577 .. 711145 (+)
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGGAACTGCTCCTGAAGGCCCTCTCAATGATGGTTATAGTTGGAGAAAATATGGCCAAAAAGATATCCATGGTGCTAATTTCCCAAGGTGAGATTCCATCTCATCAATTCTTTTTAATTTTTAATATAATGAATTAATTAGAATATTTAGTTACTGATTAACCATTTAATTCCACATGTTTGAAGAATAGTCAACGACTTAATTCAGGATGAAGAATAGTCAACAAATCTAAAGTTGCAAGTGGAGCACATGAAATTCACATATTAATTAATTAATTTAATTGGCTTAGAAAAGACATCATTAAAATTATTCTTTTCACATGTGTTTTCTTTATACAATAAACAAATCAATTAACCCTATCAACTACACAAGTTGCATTAATAAATTATATGTTCAAACGTTGGATAATTAAATGCTTTCATTTGAAAAAGTCTCTAATCTTTTGAAATTTTCTTTTTTTTTTTATATTGTAGATGTTATTATCGATGCACACATAGAAACGTCCGAGGATGTTTGGCGACAAAACAAGTTCAAAAATCCGACAATGATCCAAATATCTTCGAGGTAA

mRNA sequence

ATGGAACTGCTCCTGAAGGCCCTCTCAATGATGGTTATAGTTGGAGAAAATATGGCCAAAAAGATATCCATGGTGCTAATTTCCCAAGATGTTATTATCGATGCACACATAGAAACGTCCGAGGATGTTTGGCGACAAAACAAGTTCAAAAATCCGACAATGATCCAAATATCTTCGAGGTAA

Coding sequence (CDS)

ATGGAACTGCTCCTGAAGGCCCTCTCAATGATGGTTATAGTTGGAGAAAATATGGCCAAAAAGATATCCATGGTGCTAATTTCCCAAGATGTTATTATCGATGCACACATAGAAACGTCCGAGGATGTTTGGCGACAAAACAAGTTCAAAAATCCGACAATGATCCAAATATCTTCGAGGTAA

Protein sequence

MELLLKALSMMVIVGENMAKKISMVLISQDVIIDAHIETSEDVWRQNKFKNPTMIQISSR*
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008150 biological_process
biological_process GO:0006355 regulation of transcription, DNA-templated
cellular_component GO:0005575 cellular_component
molecular_function GO:0003674 molecular_function
molecular_function GO:0043565 sequence-specific DNA binding
molecular_function GO:0003700 transcription factor activity, sequence-specific DNA binding
This gene is associated with the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
MU44317melon EST collection version 4.0transcribed_cluster
MU62968melon EST collection version 4.0transcribed_cluster

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
MELO3C006037T1MELO3C006037T1mRNA


The following transcribed_cluster feature(s) are associated with this gene:

Feature NameUnique NameType
MU44317MU44317transcribed_cluster
MU62968MU62968transcribed_cluster


The following gene(s) are orthologous to this gene:

None

The following gene(s) are paralogous to this gene:

None

The following block(s) are covering this gene:
GeneOrganismBlock
MELO3C006037Watermelon (97103) v2mewmbB421
MELO3C006037Watermelon (97103) v2mewmbB434
MELO3C006037Watermelon (97103) v2mewmbB439
MELO3C006037Wax gourdmewgoB523
MELO3C006037Wax gourdmewgoB540
MELO3C006037Wax gourdmewgoB550
MELO3C006037Melon (DHL92) v3.5.1memeB018
MELO3C006037Melon (DHL92) v3.5.1memeB150
MELO3C006037Melon (DHL92) v3.5.1memeB151
MELO3C006037Cucumber (Gy14) v1cgymeB139
MELO3C006037Cucumber (Gy14) v1cgymeB439
MELO3C006037Cucurbita maxima (Rimu)cmameB004
MELO3C006037Cucurbita maxima (Rimu)cmameB242
MELO3C006037Cucurbita maxima (Rimu)cmameB766
MELO3C006037Cucurbita maxima (Rimu)cmameB770
MELO3C006037Cucurbita moschata (Rifu)cmomeB230
MELO3C006037Cucurbita moschata (Rifu)cmomeB755
MELO3C006037Wild cucumber (PI 183967)cpimeB230
MELO3C006037Wild cucumber (PI 183967)cpimeB291
MELO3C006037Wild cucumber (PI 183967)cpimeB399
MELO3C006037Cucumber (Chinese Long) v2cumeB297
MELO3C006037Cucumber (Chinese Long) v2cumeB236
MELO3C006037Cucumber (Chinese Long) v2cumeB402
MELO3C006037Watermelon (Charleston Gray)mewcgB420
MELO3C006037Watermelon (Charleston Gray)mewcgB427
MELO3C006037Watermelon (Charleston Gray)mewcgB430
MELO3C006037Watermelon (97103) v1mewmB478
MELO3C006037Watermelon (97103) v1mewmB461
MELO3C006037Watermelon (97103) v1mewmB466
MELO3C006037Cucurbita pepo (Zucchini)cpemeB585
MELO3C006037Cucurbita pepo (Zucchini)cpemeB698
MELO3C006037Cucurbita pepo (Zucchini)cpemeB815
MELO3C006037Bottle gourd (USVL1VR-Ls)lsimeB031
MELO3C006037Bottle gourd (USVL1VR-Ls)lsimeB378
MELO3C006037Cucumber (Gy14) v2cgybmeB200
MELO3C006037Cucumber (Gy14) v2cgybmeB252
MELO3C006037Cucumber (Gy14) v2cgybmeB349
MELO3C006037Silver-seed gourdcarmeB0222
MELO3C006037Silver-seed gourdcarmeB0968
MELO3C006037Cucumber (Chinese Long) v3cucmeB236
MELO3C006037Cucumber (Chinese Long) v3cucmeB297
MELO3C006037Cucumber (Chinese Long) v3cucmeB411