MELO3C005878 (gene) Melon (DHL92) v3.5.1

NameMELO3C005878
Typegene
OrganismCucumis melo (Melon (DHL92) v3.5.1)
Descriptionferric reduction oxidase 5
Locationchr9 : 23799930 .. 23800187 (+)
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGCATAAAAGCAACAAAAATCAAAGCAAAGCAAAAGCAAACAGAGAGAAGGAGAGGAATGAAGGATTACAGAGCAAGAACAATCAAAGCAGAGTAGAAGATTACCAGGCGTTAATTAGTGAAAATGGGAACTTTTTCAAGTTCTGGGAAAGAGACGAACAAGCGGGAAGAGAGGCAAAGAGAAGAATCTTGCAACGCAAACACGATCAGTCTCGTTCTTGGTCTCTCACTCTTTGTGGGTTTCTCCGGTTTTCTTGA

mRNA sequence

ATGCATAAAAGCAACAAAAATCAAAGCAAAGCAAAAGCAAACAGAGAGAAGGAGAGGAATGAAGGATTACAGAGCAAGAACAATCAAAGCAGAGTAGAAGATTACCAGGCGTTAATTAGTGAAAATGGGAACTTTTTCAAGTTCTGGGAAAGAGACGAACAAGCGGGAAGAGAGGCAAAGAGAAGAATCTTGCAACGCAAACACGATCAGTCTCGTTCTTGGTCTCTCACTCTTTGTGGGTTTCTCCGGTTTTCTTGA

Coding sequence (CDS)

ATGCATAAAAGCAACAAAAATCAAAGCAAAGCAAAAGCAAACAGAGAGAAGGAGAGGAATGAAGGATTACAGAGCAAGAACAATCAAAGCAGAGTAGAAGATTACCAGGCGTTAATTAGTGAAAATGGGAACTTTTTCAAGTTCTGGGAAAGAGACGAACAAGCGGGAAGAGAGGCAAAGAGAAGAATCTTGCAACGCAAACACGATCAGTCTCGTTCTTGGTCTCTCACTCTTTGTGGGTTTCTCCGGTTTTCTTGA

Protein sequence

MHKSNKNQSKAKANREKERNEGLQSKNNQSRVEDYQALISENGNFFKFWERDEQAGREAKRRILQRKHDQSRSWSLTLCGFLRFS*
The following terms have been associated with this gene:
Vocabulary: INTERPRO
TermDefinition
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008150 biological_process
cellular_component GO:0005575 cellular_component
molecular_function GO:0003674 molecular_function
This gene is associated with the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
MU52819melon EST collection version 4.0transcribed_cluster

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
MELO3C005878T1MELO3C005878T1mRNA


The following transcribed_cluster feature(s) are associated with this gene:

Feature NameUnique NameType
MU52819MU52819transcribed_cluster


Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableunknownCoilCoilcoord: 6..33
scor

The following gene(s) are orthologous to this gene:
GeneOrthologueOrganismBlock
MELO3C005878CSPI05G03250Wild cucumber (PI 183967)cpimeB348
The following gene(s) are paralogous to this gene:

None

The following block(s) are covering this gene:
GeneOrganismBlock
MELO3C005878Cucumber (Chinese Long) v3cucmeB168
MELO3C005878Cucumber (Chinese Long) v3cucmeB357
MELO3C005878Cucumber (Chinese Long) v3cucmeB369
MELO3C005878Watermelon (97103) v2mewmbB008
MELO3C005878Watermelon (97103) v2mewmbB023
MELO3C005878Watermelon (97103) v2mewmbB027
MELO3C005878Wax gourdmewgoB004
MELO3C005878Wax gourdmewgoB037
MELO3C005878Melon (DHL92) v3.5.1memeB016
MELO3C005878Melon (DHL92) v3.5.1memeB018
MELO3C005878Cucumber (Gy14) v1cgymeB367
MELO3C005878Cucumber (Gy14) v1cgymeB426
MELO3C005878Cucurbita maxima (Rimu)cmameB257
MELO3C005878Cucurbita maxima (Rimu)cmameB283
MELO3C005878Cucurbita maxima (Rimu)cmameB349
MELO3C005878Cucurbita maxima (Rimu)cmameB527
MELO3C005878Cucurbita moschata (Rifu)cmomeB198
MELO3C005878Cucurbita moschata (Rifu)cmomeB246
MELO3C005878Cucurbita moschata (Rifu)cmomeB275
MELO3C005878Cucurbita moschata (Rifu)cmomeB341
MELO3C005878Cucurbita moschata (Rifu)cmomeB515
MELO3C005878Wild cucumber (PI 183967)cpimeB166
MELO3C005878Cucumber (Chinese Long) v2cumeB175
MELO3C005878Cucumber (Chinese Long) v2cumeB357
MELO3C005878Watermelon (Charleston Gray)mewcgB026
MELO3C005878Watermelon (Charleston Gray)mewcgB018
MELO3C005878Watermelon (Charleston Gray)mewcgB030
MELO3C005878Watermelon (97103) v1mewmB018
MELO3C005878Watermelon (97103) v1mewmB022
MELO3C005878Watermelon (97103) v1mewmB029
MELO3C005878Cucurbita pepo (Zucchini)cpemeB017
MELO3C005878Cucurbita pepo (Zucchini)cpemeB148
MELO3C005878Cucurbita pepo (Zucchini)cpemeB179
MELO3C005878Cucurbita pepo (Zucchini)cpemeB651
MELO3C005878Bottle gourd (USVL1VR-Ls)lsimeB012
MELO3C005878Bottle gourd (USVL1VR-Ls)lsimeB336
MELO3C005878Bottle gourd (USVL1VR-Ls)lsimeB337
MELO3C005878Cucumber (Gy14) v2cgybmeB142
MELO3C005878Cucumber (Gy14) v2cgybmeB298
MELO3C005878Silver-seed gourdcarmeB0302
MELO3C005878Silver-seed gourdcarmeB0508
MELO3C005878Silver-seed gourdcarmeB0542
MELO3C005878Silver-seed gourdcarmeB0962