MELO3C005659 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTTGACTGTGATGATCGGCCGGTCGTTAAATCAGCCGATTACCCGAATACGGCAGTGGATACGGTGGGGCCGGCGCCGGTGTTCCGGTATTGCGGGGATGAGGAGGCTTTGGATATAGTGTTCCCGGATTGGTCCTTCTGGGGATGGTAACATCTCTTTTCTTTTCAATTTTTAATCATTTAAAATTCATTAAAATATCATTAAAAAAATGATAAGGAGTATAATTGGATATTTGAAAAATACTTTGGCGAAAATAATATTTTAATTCTTCGAATTTTAATCTTTTTATTAGGACCTTATAATTTCAATTTAGTGGCCCCCCATACGTGTTGAAATAA ATGTTTGACTGTGATGATCGGCCGGTCGTTAAATCAGCCGATTACCCGAATACGGCAGTGGATACGGTGGGGCCGGCGCCGGTGTTCCGGTATTGCGGGGATGAGGAGGCTTTGGATATAGTGTTCCCGGATTGGTCCTTCTGGGGATGTGGCCCCCCATACGTGTTGAAATAA ATGTTTGACTGTGATGATCGGCCGGTCGTTAAATCAGCCGATTACCCGAATACGGCAGTGGATACGGTGGGGCCGGCGCCGGTGTTCCGGTATTGCGGGGATGAGGAGGCTTTGGATATAGTGTTCCCGGATTGGTCCTTCTGGGGATGTGGCCCCCCATACGTGTTGAAATAA MFDCDDRPVVKSADYPNTAVDTVGPAPVFRYCGDEEALDIVFPDWSFWGCGPPYVLK*
BLAST of MELO3C005659 vs. TrEMBL
Match: A0A0A0KQX4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G154780 PE=4 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 1.3e-17 Identity = 42/49 (85.71%), Postives = 42/49 (85.71%), Query Frame = 1
BLAST of MELO3C005659 vs. TrEMBL
Match: B9RDP6_RICCO (KDEL motif-containing protein 1, putative OS=Ricinus communis GN=RCOM_1614780 PE=4 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 4.4e-13 Identity = 34/49 (69.39%), Postives = 39/49 (79.59%), Query Frame = 1
BLAST of MELO3C005659 vs. TrEMBL
Match: A0A0A0KB84_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G003390 PE=4 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 6.3e-12 Identity = 34/51 (66.67%), Postives = 38/51 (74.51%), Query Frame = 1
BLAST of MELO3C005659 vs. TrEMBL
Match: M5X7Y2_PRUPE (Uncharacterized protein (Fragment) OS=Prunus persica GN=PRUPE_ppa019065mg PE=4 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 8.3e-12 Identity = 33/49 (67.35%), Postives = 38/49 (77.55%), Query Frame = 1
BLAST of MELO3C005659 vs. TrEMBL
Match: A0A0D2RLM8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G246000 PE=4 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 2.4e-11 Identity = 32/49 (65.31%), Postives = 37/49 (75.51%), Query Frame = 1
BLAST of MELO3C005659 vs. TAIR10
Match: AT1G63420.1 (AT1G63420.1 Arabidopsis thaliana protein of unknown function (DUF821)) HSP 1 Score: 71.2 bits (173), Expect = 2.3e-13 Identity = 32/51 (62.75%), Postives = 35/51 (68.63%), Query Frame = 1
BLAST of MELO3C005659 vs. TAIR10
Match: AT3G61270.1 (AT3G61270.1 Arabidopsis thaliana protein of unknown function (DUF821)) HSP 1 Score: 70.9 bits (172), Expect = 3.0e-13 Identity = 31/49 (63.27%), Postives = 34/49 (69.39%), Query Frame = 1
BLAST of MELO3C005659 vs. TAIR10
Match: AT3G48980.1 (AT3G48980.1 Arabidopsis thaliana protein of unknown function (DUF821)) HSP 1 Score: 69.7 bits (169), Expect = 6.7e-13 Identity = 30/49 (61.22%), Postives = 35/49 (71.43%), Query Frame = 1
BLAST of MELO3C005659 vs. TAIR10
Match: AT5G23850.1 (AT5G23850.1 Arabidopsis thaliana protein of unknown function (DUF821)) HSP 1 Score: 69.3 bits (168), Expect = 8.7e-13 Identity = 29/49 (59.18%), Postives = 34/49 (69.39%), Query Frame = 1
BLAST of MELO3C005659 vs. TAIR10
Match: AT2G45830.1 (AT2G45830.1 downstream target of AGL15 2) HSP 1 Score: 66.6 bits (161), Expect = 5.7e-12 Identity = 29/49 (59.18%), Postives = 32/49 (65.31%), Query Frame = 1
BLAST of MELO3C005659 vs. NCBI nr
Match: gi|449452346|ref|XP_004143920.1| (PREDICTED: O-glucosyltransferase rumi homolog [Cucumis sativus]) HSP 1 Score: 96.3 bits (238), Expect = 1.9e-17 Identity = 42/49 (85.71%), Postives = 42/49 (85.71%), Query Frame = 1
BLAST of MELO3C005659 vs. NCBI nr
Match: gi|657942752|ref|XP_008393993.1| (PREDICTED: protein O-glucosyltransferase 1-like [Malus domestica]) HSP 1 Score: 82.4 bits (202), Expect = 2.8e-13 Identity = 38/51 (74.51%), Postives = 41/51 (80.39%), Query Frame = 1
BLAST of MELO3C005659 vs. NCBI nr
Match: gi|223549015|gb|EEF50504.1| (KDEL motif-containing protein 1 precursor, putative [Ricinus communis]) HSP 1 Score: 81.3 bits (199), Expect = 6.3e-13 Identity = 34/49 (69.39%), Postives = 39/49 (79.59%), Query Frame = 1
BLAST of MELO3C005659 vs. NCBI nr
Match: gi|1000981578|ref|XP_015583184.1| (PREDICTED: O-glucosyltransferase rumi-like, partial [Ricinus communis]) HSP 1 Score: 81.3 bits (199), Expect = 6.3e-13 Identity = 34/49 (69.39%), Postives = 39/49 (79.59%), Query Frame = 1
BLAST of MELO3C005659 vs. NCBI nr
Match: gi|1009142270|ref|XP_015888632.1| (PREDICTED: O-glucosyltransferase rumi homolog [Ziziphus jujuba]) HSP 1 Score: 78.6 bits (192), Expect = 4.1e-12 Identity = 35/51 (68.63%), Postives = 40/51 (78.43%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|