MELO3C005431.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCAAAAATAATGAATATGTATAAACAAGCCAACCTCTTTGCATTACAAGGAGGGCCGATAATATTAGTTCCAATCGAAAATGAATATGGAAATGTGACGACACCTTATGGAGATGTAGGGAAAGTGTGCTCAAATGGCGAATCTTTGAATATCGGTGTTCCATGA ATGCCAAAAATAATGAATATGTATAAACAAGCCAACCTCTTTGCATTACAAGGAGGGCCGATAATATTAGTTCCAATCGAAAATGAATATGGAAATGTGACGACACCTTATGGAGATGTAGGGAAAGTGTGCTCAAATGGCGAATCTTTGAATATCGGTGTTCCATGA ATGCCAAAAATAATGAATATGTATAAACAAGCCAACCTCTTTGCATTACAAGGAGGGCCGATAATATTAGTTCCAATCGAAAATGAATATGGAAATGTGACGACACCTTATGGAGATGTAGGGAAAGTGTGCTCAAATGGCGAATCTTTGAATATCGGTGTTCCATGA MPKIMNMYKQANLFALQGGPIILVPIENEYGNVTTPYGDVGKVCSNGESLNIGVP
BLAST of MELO3C005431.2 vs. NCBI nr
Match: XP_022960835.1 (beta-galactosidase 7-like [Cucurbita moschata]) HSP 1 Score: 80.5 bits (197), Expect = 2.0e-12 Identity = 41/58 (70.69%), Postives = 43/58 (74.14%), Query Frame = 0
BLAST of MELO3C005431.2 vs. NCBI nr
Match: XP_023521639.1 (beta-galactosidase-like, partial [Cucurbita pepo subsp. pepo]) HSP 1 Score: 80.5 bits (197), Expect = 2.0e-12 Identity = 41/58 (70.69%), Postives = 43/58 (74.14%), Query Frame = 0
BLAST of MELO3C005431.2 vs. NCBI nr
Match: XP_023516817.1 (beta-galactosidase 7-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 80.5 bits (197), Expect = 2.0e-12 Identity = 41/58 (70.69%), Postives = 43/58 (74.14%), Query Frame = 0
BLAST of MELO3C005431.2 vs. NCBI nr
Match: XP_008444022.1 (PREDICTED: beta-galactosidase-like [Cucumis melo]) HSP 1 Score: 79.0 bits (193), Expect = 5.8e-12 Identity = 41/58 (70.69%), Postives = 43/58 (74.14%), Query Frame = 0
BLAST of MELO3C005431.2 vs. NCBI nr
Match: KGN58141.1 (hypothetical protein Csa_3G550690 [Cucumis sativus]) HSP 1 Score: 79.0 bits (193), Expect = 5.8e-12 Identity = 40/58 (68.97%), Postives = 43/58 (74.14%), Query Frame = 0
BLAST of MELO3C005431.2 vs. TAIR10
Match: AT5G20710.1 (beta-galactosidase 7) HSP 1 Score: 62.4 bits (150), Expect = 1.0e-10 Identity = 34/58 (58.62%), Postives = 39/58 (67.24%), Query Frame = 0
BLAST of MELO3C005431.2 vs. TAIR10
Match: AT1G31740.1 (beta-galactosidase 15) HSP 1 Score: 60.8 bits (146), Expect = 2.9e-10 Identity = 32/57 (56.14%), Postives = 38/57 (66.67%), Query Frame = 0
BLAST of MELO3C005431.2 vs. TAIR10
Match: AT2G28470.1 (beta-galactosidase 8) HSP 1 Score: 53.9 bits (128), Expect = 3.6e-08 Identity = 29/58 (50.00%), Postives = 36/58 (62.07%), Query Frame = 0
BLAST of MELO3C005431.2 vs. TAIR10
Match: AT5G63810.1 (beta-galactosidase 10) HSP 1 Score: 53.5 bits (127), Expect = 4.7e-08 Identity = 30/57 (52.63%), Postives = 34/57 (59.65%), Query Frame = 0
BLAST of MELO3C005431.2 vs. TAIR10
Match: AT2G32810.1 (beta galactosidase 9) HSP 1 Score: 52.4 bits (124), Expect = 1.0e-07 Identity = 27/58 (46.55%), Postives = 35/58 (60.34%), Query Frame = 0
BLAST of MELO3C005431.2 vs. Swiss-Prot
Match: sp|P49676|BGAL_BRAOL (Beta-galactosidase OS=Brassica oleracea OX=3712 PE=2 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 2.8e-10 Identity = 35/58 (60.34%), Postives = 41/58 (70.69%), Query Frame = 0
BLAST of MELO3C005431.2 vs. Swiss-Prot
Match: sp|Q9SCV5|BGAL7_ARATH (Beta-galactosidase 7 OS=Arabidopsis thaliana OX=3702 GN=BGAL7 PE=2 SV=2) HSP 1 Score: 62.4 bits (150), Expect = 1.8e-09 Identity = 34/58 (58.62%), Postives = 39/58 (67.24%), Query Frame = 0
BLAST of MELO3C005431.2 vs. Swiss-Prot
Match: sp|Q9C6W4|BGA15_ARATH (Beta-galactosidase 15 OS=Arabidopsis thaliana OX=3702 GN=BGAL15 PE=2 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 5.3e-09 Identity = 32/57 (56.14%), Postives = 38/57 (66.67%), Query Frame = 0
BLAST of MELO3C005431.2 vs. Swiss-Prot
Match: sp|Q9SCV4|BGAL8_ARATH (Beta-galactosidase 8 OS=Arabidopsis thaliana OX=3702 GN=BGAL8 PE=2 SV=2) HSP 1 Score: 53.9 bits (128), Expect = 6.5e-07 Identity = 29/58 (50.00%), Postives = 36/58 (62.07%), Query Frame = 0
BLAST of MELO3C005431.2 vs. Swiss-Prot
Match: sp|Q9FN08|BGA10_ARATH (Beta-galactosidase 10 OS=Arabidopsis thaliana OX=3702 GN=BGAL10 PE=2 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 8.5e-07 Identity = 30/57 (52.63%), Postives = 34/57 (59.65%), Query Frame = 0
BLAST of MELO3C005431.2 vs. TrEMBL
Match: tr|A0A1S3BA81|A0A1S3BA81_CUCME (Beta-galactosidase OS=Cucumis melo OX=3656 GN=LOC103487469 PE=3 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 3.8e-12 Identity = 41/58 (70.69%), Postives = 43/58 (74.14%), Query Frame = 0
BLAST of MELO3C005431.2 vs. TrEMBL
Match: tr|A0A0A0LDH9|A0A0A0LDH9_CUCSA (Beta-galactosidase OS=Cucumis sativus OX=3659 GN=Csa_3G550690 PE=3 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 3.8e-12 Identity = 40/58 (68.97%), Postives = 43/58 (74.14%), Query Frame = 0
BLAST of MELO3C005431.2 vs. TrEMBL
Match: tr|A0A1S3CP45|A0A1S3CP45_CUCME (Beta-galactosidase OS=Cucumis melo OX=3656 GN=LOC103502650 PE=3 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 5.0e-12 Identity = 40/58 (68.97%), Postives = 43/58 (74.14%), Query Frame = 0
BLAST of MELO3C005431.2 vs. TrEMBL
Match: tr|A0A1S3C8Z9|A0A1S3C8Z9_CUCME (Beta-galactosidase OS=Cucumis melo OX=3656 GN=LOC103498345 PE=3 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 5.0e-12 Identity = 40/58 (68.97%), Postives = 43/58 (74.14%), Query Frame = 0
BLAST of MELO3C005431.2 vs. TrEMBL
Match: tr|A0A0A0LXX7|A0A0A0LXX7_CUCSA (Beta-galactosidase OS=Cucumis sativus OX=3659 GN=Csa_1G643050 PE=3 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 1.1e-11 Identity = 40/58 (68.97%), Postives = 42/58 (72.41%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|