MELO3C005320 (gene) Melon (DHL92) v3.5.1

NameMELO3C005320
Typegene
OrganismCucumis melo (Melon (DHL92) v3.5.1)
DescriptionPhenylalanine--tRNA ligase, mitochondrial
Locationchr9 : 19295935 .. 19296102 (+)
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGGGATCGCGGCAGCTAAGCGTGCGGCGCAGAGGGAAATGGCTCGTGGCGTTGGGCGTCGGCTTGTGTCGTGACGTTAGCGTCGATGGGAGGGGCCGACAATCGGCGAATGAAACAGAGGTGGGAGGGGGCGAGAGCGGTTGCATGAAGAAGAAGATAAAAGGATAA

mRNA sequence

ATGGGATCGCGGCAGCTAAGCGTGCGGCGCAGAGGGAAATGGCTCGTGGCGTTGGGCGTCGGCTTGTGTCGTGACGTTAGCGTCGATGGGAGGGGCCGACAATCGGCGAATGAAACAGAGGTGGGAGGGGGCGAGAGCGGTTGCATGAAGAAGAAGATAAAAGGATAA

Coding sequence (CDS)

ATGGGATCGCGGCAGCTAAGCGTGCGGCGCAGAGGGAAATGGCTCGTGGCGTTGGGCGTCGGCTTGTGTCGTGACGTTAGCGTCGATGGGAGGGGCCGACAATCGGCGAATGAAACAGAGGTGGGAGGGGGCGAGAGCGGTTGCATGAAGAAGAAGATAAAAGGATAA

Protein sequence

MGSRQLSVRRRGKWLVALGVGLCRDVSVDGRGRQSANETEVGGGESGCMKKKIKG*
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008150 biological_process
cellular_component GO:0005575 cellular_component
molecular_function GO:0003674 molecular_function
This gene is associated with the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
MU60317melon EST collection version 4.0transcribed_cluster

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
MELO3C005320T1MELO3C005320T1mRNA


The following transcribed_cluster feature(s) are associated with this gene:

Feature NameUnique NameType
MU60317MU60317transcribed_cluster


The following gene(s) are orthologous to this gene:

None

The following gene(s) are paralogous to this gene:

None

The following block(s) are covering this gene:
GeneOrganismBlock
MELO3C005320Cucumber (Chinese Long) v2cumeB346
MELO3C005320Cucumber (Chinese Long) v2cumeB367
MELO3C005320Watermelon (Charleston Gray)mewcgB019
MELO3C005320Watermelon (Charleston Gray)mewcgB028
MELO3C005320Watermelon (97103) v1mewmB020
MELO3C005320Watermelon (97103) v1mewmB030
MELO3C005320Cucurbita pepo (Zucchini)cpemeB001
MELO3C005320Cucurbita pepo (Zucchini)cpemeB018
MELO3C005320Cucurbita pepo (Zucchini)cpemeB149
MELO3C005320Cucurbita pepo (Zucchini)cpemeB361
MELO3C005320Bottle gourd (USVL1VR-Ls)lsimeB013
MELO3C005320Bottle gourd (USVL1VR-Ls)lsimeB278
MELO3C005320Cucumber (Gy14) v2cgybmeB293
MELO3C005320Cucumber (Gy14) v2cgybmeB309
MELO3C005320Silver-seed gourdcarmeB0193
MELO3C005320Silver-seed gourdcarmeB0830
MELO3C005320Silver-seed gourdcarmeB1018
MELO3C005320Cucumber (Chinese Long) v3cucmeB350
MELO3C005320Cucumber (Chinese Long) v3cucmeB366
MELO3C005320Watermelon (97103) v2mewmbB009
MELO3C005320Watermelon (97103) v2mewmbB018
MELO3C005320Watermelon (97103) v2mewmbB025
MELO3C005320Watermelon (97103) v2mewmbB032
MELO3C005320Wax gourdmewgoB012
MELO3C005320Wax gourdmewgoB047
MELO3C005320Melon (DHL92) v3.5.1memeB006
MELO3C005320Cucumber (Gy14) v1cgymeB467
MELO3C005320Cucumber (Gy14) v1cgymeB473
MELO3C005320Cucurbita maxima (Rimu)cmameB258
MELO3C005320Cucurbita maxima (Rimu)cmameB350
MELO3C005320Cucurbita maxima (Rimu)cmameB630
MELO3C005320Cucurbita maxima (Rimu)cmameB637
MELO3C005320Cucurbita maxima (Rimu)cmameB639
MELO3C005320Cucurbita moschata (Rifu)cmomeB629
MELO3C005320Cucurbita moschata (Rifu)cmomeB245
MELO3C005320Cucurbita moschata (Rifu)cmomeB342
MELO3C005320Cucurbita moschata (Rifu)cmomeB620
MELO3C005320Cucurbita moschata (Rifu)cmomeB627
MELO3C005320Wild cucumber (PI 183967)cpimeB342
MELO3C005320Wild cucumber (PI 183967)cpimeB355