MELO3C005208 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATCCAATCTTACAAGGAAGAGGCAAAGCTGAAACAAAGAATCTCTTTGCTATTTCAAAAGATGGAAAGGTTAATATTATCAACCATGTTGCCATTTCCTTAACTCATAGGATGTAACCTCACATTTACTAGGCAAAAAAGAGTTTGAAATTAACTCATTTATTCATTCCCAATCTGCAAGACGGNNNNNNNNNNNNNNNNNNNNTTGATGTTCGAGTTGCCAAAGATCTCTTAGAAAAGGGTCACCTCTATTTAGATGTCAGGTTGGTTTATATATAAATATATATAATCAAAGGTAATGAAGCTAAATAACTGAAGAGATGGTTTTGGTTGCAGGACAGTTGAAGAGTATAACAAAGGCCATGTCGAGAATGCACTAAATGTTCCTTACATGTTCTTAACCCCAAAAGGTATCAACAAGTGGTCAAGTACCTGTATGGTTTTGTTCTAAAAGTAAGCTAAAATCTACATTTTTTAGGATGTTTTGCACTGCTAAGCATTGATCTAGATGCATTTTCTTAGCTTAACTCTTGTAGGTTTGATCCTATAGAATCTGACAGTTTGCTAATGAACAGGTCGAGTTAAGAATCCTGACTTTCTAGCACAAGTTACATCCATATCAAAGAAGGAAGATCGTATAGTAGTGGTAAGAAGAAAAAGAAAAACTATTCCTCAGTGTCGCCACTTTTATATCCCAATGCAGATCCAATAGTAAAATTGAAATAAATTGCAAATTATTTACCTATTTGTGCAGGCTTGCAATAGTGGTGGTAGAGGCCTTCGCGCTTGCGTTGATCTTCTTAACGCGGTAAGATTTGAGATGCTAGAACTAATTTGCAAGGTTGACTAG ATGGATCCAATCTTACAAGGAAGAGGCAAAGCTGAAACAAAGAATCTCTTTGCTATTTCAAAAGATGGAAAGGTTAATATTATCAACCATGTTGCCATTTCCTTAACTCATAGGATGACAGTTGAAGAGTATAACAAAGGCCATGTCGAGAATGCACTAAATGTTCCTTACATGTTCTTAACCCCAAAAGGTCGAGTTAAGAATCCTGACTTTCTAGCACAAGTTACATCCATATCAAAGAAGGAAGATCGTATAGTAGTGGCTTGCAATAGTGGTGGTAGAGGCCTTCGCGCTTGCGTTGATCTTCTTAACGCGGTAAGATTTGAGATGCTAGAACTAATTTGCAAGGTTGACTAG ATGGATCCAATCTTACAAGGAAGAGGCAAAGCTGAAACAAAGAATCTCTTTGCTATTTCAAAAGATGGAAAGGTTAATATTATCAACCATGTTGCCATTTCCTTAACTCATAGGATGACAGTTGAAGAGTATAACAAAGGCCATGTCGAGAATGCACTAAATGTTCCTTACATGTTCTTAACCCCAAAAGGTCGAGTTAAGAATCCTGACTTTCTAGCACAAGTTACATCCATATCAAAGAAGGAAGATCGTATAGTAGTGGCTTGCAATAGTGGTGGTAGAGGCCTTCGCGCTTGCGTTGATCTTCTTAACGCGGTAAGATTTGAGATGCTAGAACTAATTTGCAAGGTTGACTAG MDPILQGRGKAETKNLFAISKDGKVNIINHVAISLTHRMTVEEYNKGHVENALNVPYMFLTPKGRVKNPDFLAQVTSISKKEDRIVVACNSGGRGLRACVDLLNAVRFEMLELICKVD*
BLAST of MELO3C005208 vs. Swiss-Prot
Match: STR19_ARATH (Rhodanese-like domain-containing protein 19, mitochondrial OS=Arabidopsis thaliana GN=STR19 PE=2 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 6.4e-20 Identity = 44/65 (67.69%), Postives = 52/65 (80.00%), Query Frame = 1
BLAST of MELO3C005208 vs. Swiss-Prot
Match: STR16_ARATH (Thiosulfate sulfurtransferase 16, chloroplastic OS=Arabidopsis thaliana GN=STR16 PE=1 SV=2) HSP 1 Score: 70.9 bits (172), Expect = 1.1e-11 Identity = 34/66 (51.52%), Postives = 43/66 (65.15%), Query Frame = 1
BLAST of MELO3C005208 vs. Swiss-Prot
Match: DIN1_RAPSA (Senescence-associated protein DIN1 OS=Raphanus sativus GN=DIN1 PE=2 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 4.2e-11 Identity = 32/66 (48.48%), Postives = 40/66 (60.61%), Query Frame = 1
BLAST of MELO3C005208 vs. Swiss-Prot
Match: STR18_ARATH (Thiosulfate sulfurtransferase 18 OS=Arabidopsis thaliana GN=STR18 PE=1 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 9.3e-11 Identity = 33/68 (48.53%), Postives = 44/68 (64.71%), Query Frame = 1
BLAST of MELO3C005208 vs. Swiss-Prot
Match: STR15_ARATH (Rhodanese-like domain-containing protein 15, chloroplastic OS=Arabidopsis thaliana GN=STR15 PE=2 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 2.7e-10 Identity = 31/66 (46.97%), Postives = 38/66 (57.58%), Query Frame = 1
BLAST of MELO3C005208 vs. TrEMBL
Match: A0A0A0LMB7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G270150 PE=4 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 4.6e-25 Identity = 58/66 (87.88%), Postives = 61/66 (92.42%), Query Frame = 1
BLAST of MELO3C005208 vs. TrEMBL
Match: M5WZ24_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa024101mg PE=4 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.8e-21 Identity = 51/76 (67.11%), Postives = 63/76 (82.89%), Query Frame = 1
BLAST of MELO3C005208 vs. TrEMBL
Match: A0A059C398_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_E01127 PE=4 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.5e-20 Identity = 49/66 (74.24%), Postives = 54/66 (81.82%), Query Frame = 1
BLAST of MELO3C005208 vs. TrEMBL
Match: V7AHH1_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_011G020400g PE=4 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 2.6e-20 Identity = 51/92 (55.43%), Postives = 65/92 (70.65%), Query Frame = 1
BLAST of MELO3C005208 vs. TrEMBL
Match: A0A151TLU2_CAJCA (Thiosulfate sulfurtransferase (Fragment) OS=Cajanus cajan GN=KK1_021630 PE=4 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.7e-19 Identity = 50/92 (54.35%), Postives = 64/92 (69.57%), Query Frame = 1
BLAST of MELO3C005208 vs. TAIR10
Match: AT2G21045.1 (AT2G21045.1 Rhodanese/Cell cycle control phosphatase superfamily protein) HSP 1 Score: 98.2 bits (243), Expect = 3.6e-21 Identity = 44/65 (67.69%), Postives = 52/65 (80.00%), Query Frame = 1
BLAST of MELO3C005208 vs. TAIR10
Match: AT5G66040.1 (AT5G66040.1 sulfurtransferase protein 16) HSP 1 Score: 70.9 bits (172), Expect = 6.2e-13 Identity = 34/66 (51.52%), Postives = 43/66 (65.15%), Query Frame = 1
BLAST of MELO3C005208 vs. TAIR10
Match: AT5G66170.2 (AT5G66170.2 sulfurtransferase 18) HSP 1 Score: 69.3 bits (168), Expect = 1.8e-12 Identity = 34/69 (49.28%), Postives = 45/69 (65.22%), Query Frame = 1
BLAST of MELO3C005208 vs. TAIR10
Match: AT4G35770.1 (AT4G35770.1 Rhodanese/Cell cycle control phosphatase superfamily protein) HSP 1 Score: 66.2 bits (160), Expect = 1.5e-11 Identity = 31/66 (46.97%), Postives = 38/66 (57.58%), Query Frame = 1
BLAST of MELO3C005208 vs. TAIR10
Match: AT2G17850.1 (AT2G17850.1 Rhodanese/Cell cycle control phosphatase superfamily protein) HSP 1 Score: 64.3 bits (155), Expect = 5.8e-11 Identity = 31/68 (45.59%), Postives = 42/68 (61.76%), Query Frame = 1
BLAST of MELO3C005208 vs. NCBI nr
Match: gi|659083327|ref|XP_008442292.1| (PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial [Cucumis melo]) HSP 1 Score: 144.4 bits (363), Expect = 1.2e-31 Identity = 71/79 (89.87%), Postives = 72/79 (91.14%), Query Frame = 1
BLAST of MELO3C005208 vs. NCBI nr
Match: gi|659115677|ref|XP_008457677.1| (PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial isoform X2 [Cucumis melo]) HSP 1 Score: 131.0 bits (328), Expect = 1.4e-27 Identity = 63/66 (95.45%), Postives = 64/66 (96.97%), Query Frame = 1
BLAST of MELO3C005208 vs. NCBI nr
Match: gi|659115675|ref|XP_008457676.1| (PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial isoform X1 [Cucumis melo]) HSP 1 Score: 123.6 bits (309), Expect = 2.3e-25 Identity = 63/74 (85.14%), Postives = 64/74 (86.49%), Query Frame = 1
BLAST of MELO3C005208 vs. NCBI nr
Match: gi|449458672|ref|XP_004147071.1| (PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial [Cucumis sativus]) HSP 1 Score: 122.1 bits (305), Expect = 6.6e-25 Identity = 58/66 (87.88%), Postives = 61/66 (92.42%), Query Frame = 1
BLAST of MELO3C005208 vs. NCBI nr
Match: gi|565361030|ref|XP_006347264.1| (PREDICTED: rhodanese-like domain-containing protein 19, mitochondrial [Solanum tuberosum]) HSP 1 Score: 111.3 bits (277), Expect = 1.2e-21 Identity = 48/66 (72.73%), Postives = 58/66 (87.88%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|