MELO3C005020.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTAGAATTTGTCAACGGTGTCAAAGGAATAACCTTAAATCTTGAGAATGAGAATGTAGGGATTGTTGTCTTTGGTAGTGATGCCGCTATTAAAGAAGGAGATCTTGTCAAGCGCACTGGATCAATCATGGATATTCCAGTAAGAAAGGTTATGCTCGGGCGTATGGTCGGTGCCTTGGGAGCACCCATTGATGGAAAAGGGGCTTTCAGCGATCATAAGCGAAGACGTATCAAAGTGAAAGCCCTTGAGATTATTGAATGTAAATCAGTGCACGAGCCTATGAAAATAGGGTTAAAAGTAGTGGATATCCTGTTCCAATAG ATGGTAGAATTTGTCAACGGTGTCAAAGGAATAACCTTAAATCTTGAGAATGAGAATGTAGGGATTGTTGTCTTTGGTAGTGATGCCGCTATTAAAGAAGGAGATCTTGTCAAGCGCACTGGATCAATCATGGATATTCCAGTAAGAAAGGTTATGCTCGGGCGTATGGTCGGTGCCTTGGGAGCACCCATTGATGGAAAAGGGGCTTTCAGCGATCATAAGCGAAGACGTATCAAAGTGAAAGCCCTTGAGATTATTGAATGTAAATCAGTGCACGAGCCTATGAAAATAGGGTTAAAAGTAGTGGATATCCTGTTCCAATAG ATGGTAGAATTTGTCAACGGTGTCAAAGGAATAACCTTAAATCTTGAGAATGAGAATGTAGGGATTGTTGTCTTTGGTAGTGATGCCGCTATTAAAGAAGGAGATCTTGTCAAGCGCACTGGATCAATCATGGATATTCCAGTAAGAAAGGTTATGCTCGGGCGTATGGTCGGTGCCTTGGGAGCACCCATTGATGGAAAAGGGGCTTTCAGCGATCATAAGCGAAGACGTATCAAAGTGAAAGCCCTTGAGATTATTGAATGTAAATCAGTGCACGAGCCTATGAAAATAGGGTTAAAAGTAGTGGATATCCTGTTCCAATAG MVEFVNGVKGITLNLENENVGIVVFGSDAAIKEGDLVKRTGSIMDIPVRKVMLGRMVGALGAPIDGKGAFSDHKRRRIKVKALEIIECKSVHEPMKIGLKVVDILFQ
BLAST of MELO3C005020.2 vs. NCBI nr
Match: BAJ22083.1 (ATPase subunit 1, partial (mitochondrion) [Cycas taitungensis]) HSP 1 Score: 163.3 bits (412), Expect = 4.5e-37 Identity = 83/105 (79.05%), Postives = 91/105 (86.67%), Query Frame = 0
BLAST of MELO3C005020.2 vs. NCBI nr
Match: AUD38671.1 (ATP synthase F1 subunit 1 (mitochondrion) [Colletoecema dewevrei]) HSP 1 Score: 162.5 bits (410), Expect = 7.7e-37 Identity = 82/105 (78.10%), Postives = 90/105 (85.71%), Query Frame = 0
BLAST of MELO3C005020.2 vs. NCBI nr
Match: AAF17039.1 (ATPase alpha subunit, partial (mitochondrion) [Carludovica palmata]) HSP 1 Score: 162.2 bits (409), Expect = 1.0e-36 Identity = 82/105 (78.10%), Postives = 90/105 (85.71%), Query Frame = 0
BLAST of MELO3C005020.2 vs. NCBI nr
Match: AAM12427.1 (ATP synthase alpha subunit, partial (mitochondrion) [Cornus suecica]) HSP 1 Score: 162.2 bits (409), Expect = 1.0e-36 Identity = 82/105 (78.10%), Postives = 90/105 (85.71%), Query Frame = 0
BLAST of MELO3C005020.2 vs. NCBI nr
Match: AAQ74518.1 (F1-ATPase alpha subunit, partial (mitochondrion) [Cyclanthus bipartitus]) HSP 1 Score: 162.2 bits (409), Expect = 1.0e-36 Identity = 82/105 (78.10%), Postives = 90/105 (85.71%), Query Frame = 0
BLAST of MELO3C005020.2 vs. TAIR10
Match: AT2G07698.1 (ATPase, F1 complex, alpha subunit protein) HSP 1 Score: 154.8 bits (390), Expect = 2.9e-38 Identity = 77/105 (73.33%), Postives = 88/105 (83.81%), Query Frame = 0
BLAST of MELO3C005020.2 vs. TAIR10
Match: ATMG01190.1 (ATP synthase subunit 1) HSP 1 Score: 154.8 bits (390), Expect = 2.9e-38 Identity = 77/105 (73.33%), Postives = 88/105 (83.81%), Query Frame = 0
BLAST of MELO3C005020.2 vs. TAIR10
Match: ATCG00120.1 (ATP synthase subunit alpha) HSP 1 Score: 93.6 bits (231), Expect = 8.0e-20 Identity = 49/103 (47.57%), Postives = 65/103 (63.11%), Query Frame = 0
BLAST of MELO3C005020.2 vs. Swiss-Prot
Match: sp|P05494|ATPAM_MAIZE (ATP synthase subunit alpha, mitochondrial OS=Zea mays OX=4577 GN=ATPA PE=3 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 4.3e-39 Identity = 82/105 (78.10%), Postives = 90/105 (85.71%), Query Frame = 0
BLAST of MELO3C005020.2 vs. Swiss-Prot
Match: sp|P0C520|ATPAM_ORYSA (ATP synthase subunit alpha, mitochondrial OS=Oryza sativa OX=4530 GN=ATPA PE=3 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 4.3e-39 Identity = 82/105 (78.10%), Postives = 90/105 (85.71%), Query Frame = 0
BLAST of MELO3C005020.2 vs. Swiss-Prot
Match: sp|P0C521|ATPAM_ORYSI (ATP synthase subunit alpha, mitochondrial OS=Oryza sativa subsp. indica OX=39946 GN=ATPA PE=3 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 4.3e-39 Identity = 82/105 (78.10%), Postives = 90/105 (85.71%), Query Frame = 0
BLAST of MELO3C005020.2 vs. Swiss-Prot
Match: sp|P0C522|ATPAM_ORYSJ (ATP synthase subunit alpha, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=ATPA PE=1 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 4.3e-39 Identity = 82/105 (78.10%), Postives = 90/105 (85.71%), Query Frame = 0
BLAST of MELO3C005020.2 vs. Swiss-Prot
Match: sp|P12862|ATPAM_WHEAT (ATP synthase subunit alpha, mitochondrial OS=Triticum aestivum OX=4565 GN=ATPA PE=3 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 4.3e-39 Identity = 82/105 (78.10%), Postives = 90/105 (85.71%), Query Frame = 0
BLAST of MELO3C005020.2 vs. TrEMBL
Match: tr|E1CBG2|E1CBG2_CYCTA (ATPase subunit 1 (Fragment) OS=Cycas taitungensis OX=54799 GN=atp1 PE=2 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 3.0e-37 Identity = 83/105 (79.05%), Postives = 91/105 (86.67%), Query Frame = 0
BLAST of MELO3C005020.2 vs. TrEMBL
Match: tr|M8C108|M8C108_AEGTA (ATP synthase subunit alpha, mitochondrial OS=Aegilops tauschii OX=37682 GN=F775_20153 PE=3 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 3.9e-37 Identity = 82/105 (78.10%), Postives = 90/105 (85.71%), Query Frame = 0
BLAST of MELO3C005020.2 vs. TrEMBL
Match: tr|A0A2H4WZE0|A0A2H4WZE0_9GENT (ATP synthase subunit alpha OS=Colletoecema dewevrei OX=110689 GN=atp1 PE=3 SV=1) HSP 1 Score: 162.5 bits (410), Expect = 5.1e-37 Identity = 82/105 (78.10%), Postives = 90/105 (85.71%), Query Frame = 0
BLAST of MELO3C005020.2 vs. TrEMBL
Match: tr|S4W7Y4|S4W7Y4_9LILI (ATP synthase subunit alpha (Fragment) OS=Carludovica palmata OX=108411 GN=atpA PE=3 SV=1) HSP 1 Score: 162.2 bits (409), Expect = 6.7e-37 Identity = 82/105 (78.10%), Postives = 90/105 (85.71%), Query Frame = 0
BLAST of MELO3C005020.2 vs. TrEMBL
Match: tr|Q9T721|Q9T721_9LILI (ATP synthase subunit alpha (Fragment) OS=Carludovica palmata OX=108411 GN=atp1 PE=3 SV=1) HSP 1 Score: 162.2 bits (409), Expect = 6.7e-37 Identity = 82/105 (78.10%), Postives = 90/105 (85.71%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |