MELO3C004973.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCACCCGAGATTTGCAACGATGAAATATTTGACAGAAGCATCGATTCATTTTCATTCGGTCTCATTTTATACGAGGTATCTACAATTCAATTTCTTTTTTCATTTCCTTAATCTTTCTGTATTATTAAGAGTTGATTCGCATTTGGAAGCAATTTTTTTATCACTTGATAATGACTTCTTTTGTATTTGTATATAATTTGGTTTTCATGGACAGATGGTTGAAGGTATTCAACCATTCCATCGAAAGCCTTCAGAAGAGGTTGCCAAAGCTATTTGTGTAGAAGGAAAGAGACCTCTATTTAAGATCAAATCAAAAATTTATCCACCTGATATAAAAGAGTAA ATGGCACCCGAGATTTGCAACGATGAAATATTTGACAGAAGCATCGATTCATTTTCATTCGGTCTCATTTTATACGAGATGGTTGAAGGTATTCAACCATTCCATCGAAAGCCTTCAGAAGAGGTTGCCAAAGCTATTTGTGTAGAAGGAAAGAGACCTCTATTTAAGATCAAATCAAAAATTTATCCACCTGATATAAAAGAGTAA ATGGCACCCGAGATTTGCAACGATGAAATATTTGACAGAAGCATCGATTCATTTTCATTCGGTCTCATTTTATACGAGATGGTTGAAGGTATTCAACCATTCCATCGAAAGCCTTCAGAAGAGGTTGCCAAAGCTATTTGTGTAGAAGGAAAGAGACCTCTATTTAAGATCAAATCAAAAATTTATCCACCTGATATAAAAGAGTAA MAPEICNDEIFDRSIDSFSFGLILYEMVEGIQPFHRKPSEEVAKAICVEGKRPLFKIKSKIYPPDIKE
BLAST of MELO3C004973.2 vs. NCBI nr
Match: XP_008455271.1 (PREDICTED: dual specificity protein kinase shkC-like isoform X1 [Cucumis melo] >XP_016901767.1 PREDICTED: dual specificity protein kinase shkC-like isoform X1 [Cucumis melo]) HSP 1 Score: 124.8 bits (312), Expect = 1.1e-25 Identity = 58/68 (85.29%), Postives = 62/68 (91.18%), Query Frame = 0
BLAST of MELO3C004973.2 vs. NCBI nr
Match: XP_008455272.1 (PREDICTED: dual specificity protein kinase shkC-like isoform X2 [Cucumis melo]) HSP 1 Score: 124.8 bits (312), Expect = 1.1e-25 Identity = 58/68 (85.29%), Postives = 62/68 (91.18%), Query Frame = 0
BLAST of MELO3C004973.2 vs. NCBI nr
Match: XP_022157650.1 (dual specificity protein kinase shkC-like [Momordica charantia]) HSP 1 Score: 121.7 bits (304), Expect = 9.6e-25 Identity = 56/68 (82.35%), Postives = 62/68 (91.18%), Query Frame = 0
BLAST of MELO3C004973.2 vs. NCBI nr
Match: XP_004136851.1 (PREDICTED: dual specificity protein kinase shkC-like [Cucumis sativus] >KGN43659.1 hypothetical protein Csa_7G051390 [Cucumis sativus]) HSP 1 Score: 121.3 bits (303), Expect = 1.3e-24 Identity = 56/68 (82.35%), Postives = 61/68 (89.71%), Query Frame = 0
BLAST of MELO3C004973.2 vs. NCBI nr
Match: XP_022927692.1 (integrin-linked protein kinase 1-like isoform X2 [Cucurbita moschata]) HSP 1 Score: 117.9 bits (294), Expect = 1.4e-23 Identity = 53/68 (77.94%), Postives = 61/68 (89.71%), Query Frame = 0
BLAST of MELO3C004973.2 vs. TAIR10
Match: AT2G31800.1 (Integrin-linked protein kinase family) HSP 1 Score: 102.8 bits (255), Expect = 8.4e-23 Identity = 43/68 (63.24%), Postives = 56/68 (82.35%), Query Frame = 0
BLAST of MELO3C004973.2 vs. TAIR10
Match: AT2G43850.1 (Integrin-linked protein kinase family) HSP 1 Score: 98.2 bits (243), Expect = 2.1e-21 Identity = 42/68 (61.76%), Postives = 55/68 (80.88%), Query Frame = 0
BLAST of MELO3C004973.2 vs. TAIR10
Match: AT3G59830.1 (Integrin-linked protein kinase family) HSP 1 Score: 95.5 bits (236), Expect = 1.3e-20 Identity = 41/68 (60.29%), Postives = 53/68 (77.94%), Query Frame = 0
BLAST of MELO3C004973.2 vs. TAIR10
Match: AT3G58760.1 (Integrin-linked protein kinase family) HSP 1 Score: 65.9 bits (159), Expect = 1.1e-11 Identity = 32/68 (47.06%), Postives = 43/68 (63.24%), Query Frame = 0
BLAST of MELO3C004973.2 vs. TAIR10
Match: AT4G18950.1 (Integrin-linked protein kinase family) HSP 1 Score: 58.5 bits (140), Expect = 1.8e-09 Identity = 32/68 (47.06%), Postives = 40/68 (58.82%), Query Frame = 0
BLAST of MELO3C004973.2 vs. Swiss-Prot
Match: sp|F4IS56|ILK1_ARATH (Integrin-linked protein kinase 1 OS=Arabidopsis thaliana OX=3702 GN=ILK1 PE=1 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 3.7e-20 Identity = 42/68 (61.76%), Postives = 55/68 (80.88%), Query Frame = 0
BLAST of MELO3C004973.2 vs. Swiss-Prot
Match: sp|P34722|KPC1_CAEEL (Protein kinase C-like 1 OS=Caenorhabditis elegans OX=6239 GN=tpa-1 PE=1 SV=2) HSP 1 Score: 47.8 bits (112), Expect = 5.8e-05 Identity = 20/55 (36.36%), Postives = 37/55 (67.27%), Query Frame = 0
BLAST of MELO3C004973.2 vs. Swiss-Prot
Match: sp|Q9ZQ31|STY13_ARATH (Serine/threonine-protein kinase STY13 OS=Arabidopsis thaliana OX=3702 GN=STY13 PE=1 SV=2) HSP 1 Score: 47.8 bits (112), Expect = 5.8e-05 Identity = 18/53 (33.96%), Postives = 33/53 (62.26%), Query Frame = 0
BLAST of MELO3C004973.2 vs. Swiss-Prot
Match: sp|Q54Y55|SHKC_DICDI (Dual specificity protein kinase shkC OS=Dictyostelium discoideum OX=44689 GN=shkC PE=3 SV=1) HSP 1 Score: 47.4 bits (111), Expect = 7.5e-05 Identity = 21/54 (38.89%), Postives = 37/54 (68.52%), Query Frame = 0
BLAST of MELO3C004973.2 vs. Swiss-Prot
Match: sp|P36583|PCK2_SCHPO (Protein kinase C-like 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pck2 PE=1 SV=2) HSP 1 Score: 47.0 bits (110), Expect = 9.8e-05 Identity = 22/57 (38.60%), Postives = 37/57 (64.91%), Query Frame = 0
BLAST of MELO3C004973.2 vs. TrEMBL
Match: tr|A0A1S3C0I9|A0A1S3C0I9_CUCME (dual specificity protein kinase shkC-like isoform X1 OS=Cucumis melo OX=3656 GN=LOC103495475 PE=4 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 7.5e-26 Identity = 58/68 (85.29%), Postives = 62/68 (91.18%), Query Frame = 0
BLAST of MELO3C004973.2 vs. TrEMBL
Match: tr|A0A1S3C195|A0A1S3C195_CUCME (dual specificity protein kinase shkC-like isoform X2 OS=Cucumis melo OX=3656 GN=LOC103495475 PE=4 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 7.5e-26 Identity = 58/68 (85.29%), Postives = 62/68 (91.18%), Query Frame = 0
BLAST of MELO3C004973.2 vs. TrEMBL
Match: tr|A0A0A0K3V6|A0A0A0K3V6_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G051390 PE=4 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 8.3e-25 Identity = 56/68 (82.35%), Postives = 61/68 (89.71%), Query Frame = 0
BLAST of MELO3C004973.2 vs. TrEMBL
Match: tr|A5BSW6|A5BSW6_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VITISV_010336 PE=4 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 1.0e-22 Identity = 50/68 (73.53%), Postives = 58/68 (85.29%), Query Frame = 0
BLAST of MELO3C004973.2 vs. TrEMBL
Match: tr|F6HAY7|F6HAY7_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VIT_05s0094g01080 PE=4 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 1.0e-22 Identity = 50/68 (73.53%), Postives = 58/68 (85.29%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|