MELO3C004970.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTGATGTTGAAGGTTCTCCAGGAAGCTCAATGCATGGAGTGACTGGAAGAGAACAAACCTTTGCATTCTCTGTAGCTTCCCCGATCGTCCCAACTGACACGACCGCTAAATTTGCATTACCGGTCGACTCGGAGCATAAAGCTAAGGTTTTCAGGCTATGGTCTTTAGCCAACCCCCACATGAGAACCTTCCACCTTTCTTGGATTTCCTTCTTCACATGCTTTGTGTCGACGTTCGCAGCTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNgTTTGCATCAACAAAGTATTAAGTTTGCTGAGAATAGCAGATCTGAACGTGGTAGGCGTGTTGCTTCAGCTCCAACTCCACCAAATACAACTCCTTCTCATGTTTGA ATGGGTGATGTTGAAGGTTCTCCAGGAAGCTCAATGCATGGAGTGACTGGAAGAGAACAAACCTTTGCATTCTCTGTAGCTTCCCCGATCGTCCCAACTGACACGACCGCTAAATTTGCATTACCGGTCGACTCGGAGCATAAAGCTAAGGTTTTCAGGCTATGGCGTGTTGCTTCAGCTCCAACTCCACCAAATACAACTCCTTCTCATGTTTGA ATGGGTGATGTTGAAGGTTCTCCAGGAAGCTCAATGCATGGAGTGACTGGAAGAGAACAAACCTTTGCATTCTCTGTAGCTTCCCCGATCGTCCCAACTGACACGACCGCTAAATTTGCATTACCGGTCGACTCGGAGCATAAAGCTAAGGTTTTCAGGCTATGGCGTGTTGCTTCAGCTCCAACTCCACCAAATACAACTCCTTCTCATGTTTGA MGDVEGSPGSSMHGVTGREQTFAFSVASPIVPTDTTAKFALPVDSEHKAKVFRLWRVASAPTPPNTTPSHV
BLAST of MELO3C004970.2 vs. NCBI nr
Match: NP_001269063.1 (high affinity nitrate transporter 2.4-like [Cucumis sativus] >AGO64298.1 high-affinity nitrate transporter NRT2.2 [Cucumis sativus]) HSP 1 Score: 115.5 bits (288), Expect = 7.2e-23 Identity = 55/59 (93.22%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MELO3C004970.2 vs. NCBI nr
Match: NP_001274401.1 (high affinity nitrate transporter 2.4-like [Cucumis sativus] >AAS93686.3 high-affinity nitrate transporter [Cucumis sativus]) HSP 1 Score: 115.5 bits (288), Expect = 7.2e-23 Identity = 55/59 (93.22%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MELO3C004970.2 vs. NCBI nr
Match: KGN64790.1 (hypothetical protein Csa_1G097685 [Cucumis sativus]) HSP 1 Score: 115.5 bits (288), Expect = 7.2e-23 Identity = 55/59 (93.22%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MELO3C004970.2 vs. NCBI nr
Match: KGN64791.1 (hypothetical protein Csa_1G097690 [Cucumis sativus]) HSP 1 Score: 115.5 bits (288), Expect = 7.2e-23 Identity = 55/59 (93.22%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MELO3C004970.2 vs. NCBI nr
Match: XP_011660054.1 (PREDICTED: high affinity nitrate transporter 2.4-like isoform X1 [Cucumis sativus]) HSP 1 Score: 115.5 bits (288), Expect = 7.2e-23 Identity = 55/59 (93.22%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MELO3C004970.2 vs. TAIR10
Match: AT1G08090.1 (nitrate transporter 2:1) HSP 1 Score: 89.0 bits (219), Expect = 1.3e-18 Identity = 44/58 (75.86%), Postives = 48/58 (82.76%), Query Frame = 0
BLAST of MELO3C004970.2 vs. TAIR10
Match: AT5G60770.1 (nitrate transporter 2.4) HSP 1 Score: 85.9 bits (211), Expect = 1.1e-17 Identity = 40/54 (74.07%), Postives = 48/54 (88.89%), Query Frame = 0
BLAST of MELO3C004970.2 vs. TAIR10
Match: AT5G60780.1 (nitrate transporter 2.3) HSP 1 Score: 63.9 bits (154), Expect = 4.5e-11 Identity = 33/51 (64.71%), Postives = 39/51 (76.47%), Query Frame = 0
BLAST of MELO3C004970.2 vs. TAIR10
Match: AT1G08100.1 (nitrate transporter 2.2) HSP 1 Score: 62.4 bits (150), Expect = 1.3e-10 Identity = 34/58 (58.62%), Postives = 42/58 (72.41%), Query Frame = 0
BLAST of MELO3C004970.2 vs. TAIR10
Match: AT3G45060.1 (high affinity nitrate transporter 2.6) HSP 1 Score: 62.4 bits (150), Expect = 1.3e-10 Identity = 32/55 (58.18%), Postives = 40/55 (72.73%), Query Frame = 0
BLAST of MELO3C004970.2 vs. Swiss-Prot
Match: sp|O82811|NRT21_ARATH (High-affinity nitrate transporter 2.1 OS=Arabidopsis thaliana OX=3702 GN=NRT2.1 PE=1 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 2.4e-17 Identity = 44/58 (75.86%), Postives = 48/58 (82.76%), Query Frame = 0
BLAST of MELO3C004970.2 vs. Swiss-Prot
Match: sp|Q9FJH8|NRT24_ARATH (High affinity nitrate transporter 2.4 OS=Arabidopsis thaliana OX=3702 GN=NRT2.4 PE=2 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 2.0e-16 Identity = 40/54 (74.07%), Postives = 48/54 (88.89%), Query Frame = 0
BLAST of MELO3C004970.2 vs. Swiss-Prot
Match: sp|Q9FJH7|NRT23_ARATH (High affinity nitrate transporter 2.3 OS=Arabidopsis thaliana OX=3702 GN=NRT2.3 PE=1 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 8.1e-10 Identity = 33/51 (64.71%), Postives = 39/51 (76.47%), Query Frame = 0
BLAST of MELO3C004970.2 vs. Swiss-Prot
Match: sp|Q9LMZ9|NRT22_ARATH (High-affinity nitrate transporter 2.2 OS=Arabidopsis thaliana OX=3702 GN=NRT2.2 PE=2 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 2.4e-09 Identity = 34/58 (58.62%), Postives = 42/58 (72.41%), Query Frame = 0
BLAST of MELO3C004970.2 vs. Swiss-Prot
Match: sp|Q9LXH0|NRT26_ARATH (High affinity nitrate transporter 2.6 OS=Arabidopsis thaliana OX=3702 GN=NRT2.6 PE=1 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 2.4e-09 Identity = 32/55 (58.18%), Postives = 40/55 (72.73%), Query Frame = 0
BLAST of MELO3C004970.2 vs. TrEMBL
Match: tr|S4VM42|S4VM42_CUCSA (High-affinity nitrate transporter NRT2.2 OS=Cucumis sativus OX=3659 GN=NRT2.2 PE=2 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 4.7e-23 Identity = 55/59 (93.22%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MELO3C004970.2 vs. TrEMBL
Match: tr|Q6PRP8|Q6PRP8_CUCSA (High-affinity nitrate transporter OS=Cucumis sativus OX=3659 GN=NRT2 PE=2 SV=3) HSP 1 Score: 115.5 bits (288), Expect = 4.7e-23 Identity = 55/59 (93.22%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MELO3C004970.2 vs. TrEMBL
Match: tr|A0A0A0LS93|A0A0A0LS93_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G097685 PE=4 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 4.7e-23 Identity = 55/59 (93.22%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MELO3C004970.2 vs. TrEMBL
Match: tr|A0A0A0LXS3|A0A0A0LXS3_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G097690 PE=4 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 4.7e-23 Identity = 55/59 (93.22%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MELO3C004970.2 vs. TrEMBL
Match: tr|A0A2C9V1B3|A0A2C9V1B3_MANES (Uncharacterized protein OS=Manihot esculenta OX=3983 GN=MANES_11G149900 PE=4 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 2.6e-21 Identity = 51/59 (86.44%), Postives = 56/59 (94.92%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|