MELO3C004970 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTGATGTTGAAGGTTCTCCAGGAAGCTCAATGCATGGAGTGACTGGAAGAGAACAAACCTTTGCATTCTCTGTAGCTTCCCCGATCGTCCCAACTGACACGACCGCTAAATTTGCATTACCGGTCGACTCGGAGCATAAAGCTAAGGTTTTCAGGCTATGGTCTTTAGCCAACCCCCACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATCTGAACGTGGTAGGCGTGTTGCTTCAGCTCCAACTCCACCAAATACAACTCCTTCTCATGTTTGA ATGGGTGATGTTGAAGGTTCTCCAGGAAGCTCAATGCATGGAGTGACTGGAAGAGAACAAACCTTTGCATTCTCTGTAGCTTCCCCGATCGTCCCAACTGACACGACCGCTAAATTTGCATTACCGGTCGACTCGGAGCATAAAGCTAAGGTTTTCAGGCTATGGCGTGTTGCTTCAGCTCCAACTCCACCAAATACAACTCCTTCTCATGTTTGA ATGGGTGATGTTGAAGGTTCTCCAGGAAGCTCAATGCATGGAGTGACTGGAAGAGAACAAACCTTTGCATTCTCTGTAGCTTCCCCGATCGTCCCAACTGACACGACCGCTAAATTTGCATTACCGGTCGACTCGGAGCATAAAGCTAAGGTTTTCAGGCTATGGCGTGTTGCTTCAGCTCCAACTCCACCAAATACAACTCCTTCTCATGTTTGA MGDVEGSPGSSMHGVTGREQTFAFSVASPIVPTDTTAKFALPVDSEHKAKVFRLWRVASAPTPPNTTPSHV*
BLAST of MELO3C004970 vs. Swiss-Prot
Match: NRT21_ARATH (High-affinity nitrate transporter 2.1 OS=Arabidopsis thaliana GN=NRT2.1 PE=1 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 1.4e-17 Identity = 44/58 (75.86%), Postives = 46/58 (79.31%), Query Frame = 1
BLAST of MELO3C004970 vs. Swiss-Prot
Match: NRT24_ARATH (High affinity nitrate transporter 2.4 OS=Arabidopsis thaliana GN=NRT2.4 PE=2 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 1.2e-16 Identity = 40/54 (74.07%), Postives = 46/54 (85.19%), Query Frame = 1
BLAST of MELO3C004970 vs. Swiss-Prot
Match: NRT23_ARATH (High affinity nitrate transporter 2.3 OS=Arabidopsis thaliana GN=NRT2.3 PE=1 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 3.6e-10 Identity = 33/51 (64.71%), Postives = 37/51 (72.55%), Query Frame = 1
BLAST of MELO3C004970 vs. Swiss-Prot
Match: NRT26_ARATH (High affinity nitrate transporter 2.6 OS=Arabidopsis thaliana GN=NRT2.6 PE=1 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.1e-09 Identity = 32/55 (58.18%), Postives = 38/55 (69.09%), Query Frame = 1
BLAST of MELO3C004970 vs. Swiss-Prot
Match: NRT22_ARATH (High-affinity nitrate transporter 2.2 OS=Arabidopsis thaliana GN=NRT2.2 PE=2 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 1.8e-09 Identity = 34/58 (58.62%), Postives = 40/58 (68.97%), Query Frame = 1
BLAST of MELO3C004970 vs. TrEMBL
Match: Q6PRP8_CUCSA (High-affinity nitrate transporter OS=Cucumis sativus GN=NRT2 PE=2 SV=3) HSP 1 Score: 116.3 bits (290), Expect = 1.5e-23 Identity = 55/59 (93.22%), Postives = 58/59 (98.31%), Query Frame = 1
BLAST of MELO3C004970 vs. TrEMBL
Match: Q6PRP8_CUCSA (High-affinity nitrate transporter OS=Cucumis sativus GN=NRT2 PE=2 SV=3) HSP 1 Score: 34.7 bits (78), Expect = 5.8e+01 Identity = 15/16 (93.75%), Postives = 15/16 (93.75%), Query Frame = 1
HSP 2 Score: 116.3 bits (290), Expect = 1.5e-23 Identity = 55/59 (93.22%), Postives = 58/59 (98.31%), Query Frame = 1
BLAST of MELO3C004970 vs. TrEMBL
Match: S4VM42_CUCSA (High-affinity nitrate transporter NRT2.2 OS=Cucumis sativus GN=NRT2.2 PE=2 SV=1) HSP 1 Score: 36.6 bits (83), Expect = 1.5e+01 Identity = 15/16 (93.75%), Postives = 16/16 (100.00%), Query Frame = 1
HSP 2 Score: 116.3 bits (290), Expect = 1.5e-23 Identity = 55/59 (93.22%), Postives = 58/59 (98.31%), Query Frame = 1
BLAST of MELO3C004970 vs. TrEMBL
Match: A0A0A0LXS3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G097690 PE=4 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 1.5e-23 Identity = 55/59 (93.22%), Postives = 58/59 (98.31%), Query Frame = 1
BLAST of MELO3C004970 vs. TrEMBL
Match: B9SCG8_RICCO (Nitrate transporter, putative OS=Ricinus communis GN=RCOM_0472320 PE=4 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 3.2e-21 Identity = 52/59 (88.14%), Postives = 56/59 (94.92%), Query Frame = 1
BLAST of MELO3C004970 vs. TAIR10
Match: AT1G08090.1 (AT1G08090.1 nitrate transporter 2:1) HSP 1 Score: 89.7 bits (221), Expect = 7.7e-19 Identity = 44/58 (75.86%), Postives = 46/58 (79.31%), Query Frame = 1
BLAST of MELO3C004970 vs. TAIR10
Match: AT5G60770.1 (AT5G60770.1 nitrate transporter 2.4) HSP 1 Score: 86.7 bits (213), Expect = 6.6e-18 Identity = 40/54 (74.07%), Postives = 46/54 (85.19%), Query Frame = 1
BLAST of MELO3C004970 vs. TAIR10
Match: AT5G60780.1 (AT5G60780.1 nitrate transporter 2.3) HSP 1 Score: 65.1 bits (157), Expect = 2.0e-11 Identity = 33/51 (64.71%), Postives = 37/51 (72.55%), Query Frame = 1
BLAST of MELO3C004970 vs. TAIR10
Match: AT3G45060.1 (AT3G45060.1 high affinity nitrate transporter 2.6) HSP 1 Score: 63.5 bits (153), Expect = 5.9e-11 Identity = 32/55 (58.18%), Postives = 38/55 (69.09%), Query Frame = 1
BLAST of MELO3C004970 vs. TAIR10
Match: AT1G08100.1 (AT1G08100.1 nitrate transporter 2.2) HSP 1 Score: 62.8 bits (151), Expect = 1.0e-10 Identity = 34/58 (58.62%), Postives = 40/58 (68.97%), Query Frame = 1
BLAST of MELO3C004970 vs. NCBI nr
Match: gi|566006096|ref|NP_001274401.1| (high affinity nitrate transporter 2.4-like [Cucumis sativus]) HSP 1 Score: 116.3 bits (290), Expect = 2.2e-23 Identity = 55/59 (93.22%), Postives = 58/59 (98.31%), Query Frame = 1
BLAST of MELO3C004970 vs. NCBI nr
Match: gi|566006096|ref|NP_001274401.1| (high affinity nitrate transporter 2.4-like [Cucumis sativus]) HSP 1 Score: 34.7 bits (78), Expect = 8.4e+01 Identity = 15/16 (93.75%), Postives = 15/16 (93.75%), Query Frame = 1
HSP 2 Score: 116.3 bits (290), Expect = 2.2e-23 Identity = 55/59 (93.22%), Postives = 58/59 (98.31%), Query Frame = 1
BLAST of MELO3C004970 vs. NCBI nr
Match: gi|530788334|ref|NP_001269063.1| (high affinity nitrate transporter 2.4-like [Cucumis sativus]) HSP 1 Score: 36.6 bits (83), Expect = 2.2e+01 Identity = 15/16 (93.75%), Postives = 16/16 (100.00%), Query Frame = 1
HSP 2 Score: 116.3 bits (290), Expect = 2.2e-23 Identity = 55/59 (93.22%), Postives = 58/59 (98.31%), Query Frame = 1
BLAST of MELO3C004970 vs. NCBI nr
Match: gi|700209694|gb|KGN64790.1| (hypothetical protein Csa_1G097685 [Cucumis sativus]) HSP 1 Score: 116.3 bits (290), Expect = 2.2e-23 Identity = 55/59 (93.22%), Postives = 58/59 (98.31%), Query Frame = 1
BLAST of MELO3C004970 vs. NCBI nr
Match: gi|778655167|ref|XP_011660054.1| (PREDICTED: high affinity nitrate transporter 2.4-like isoform X1 [Cucumis sativus]) HSP 1 Score: 116.3 bits (290), Expect = 2.2e-23 Identity = 55/59 (93.22%), Postives = 58/59 (98.31%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|