MELO3C004868.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: five_prime_UTRexonpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.CCCGATATTGGAATCTCCAGCAAAGCCATGGGTATTATGAACAGTTTTATCAACGACATTTTCGAGAAGCTCGCTCAGGAATCCTCAAAGCTCGCTCGCTACAACAAAAAGCCGACCATAACCTCTCGGGAGATCCAAACGGCTGTGCGCCTTGTTCTTCCTGGTGAGTTGGCTAAACACGCCGTCTCTGAGGGTACCAAGGCTGTTACCAAGTTTACTAGCTCTTAGATTCACAGATTAGGGTTTTCTTGTGTAAAAAGCGGCCTGATTGTTCTGAATCGTTGACTTAGCTTCCTTTTTGTTGCATATTTTGGAATCAATTGAATGAAAAGTCGGTTTTTGTTAAGCGATTTCTCTATTTTCCTTCTTAATTTTATATTGTACTCTGTCCAATGGAACTCTGAAGATTGCTTCCTCTTTTGTCTATGGCTTGATGAGTTCATGTAGTCGCGCATTTTTAGCAATTAAAATCGAAATTTTAAATTCTTTTC CCCGATATTGGAATCTCCAGCAAAGCCATGGGTATTATGAACAGTTTTATCAACGACATTTTCGAGAAGCTCGCTCAGGAATCCTCAAAGCTCGCTCGCTACAACAAAAAGCCGACCATAACCTCTCGGGAGATCCAAACGGCTGTGCGCCTTGTTCTTCCTGGTGAGTTGGCTAAACACGCCGTCTCTGAGGGTACCAAGGCTGTTACCAAGTTTACTAGCTCTTAGATTCACAGATTAGGGTTTTCTTGTGTAAAAAGCGGCCTGATTGTTCTGAATCGTTGACTTAGCTTCCTTTTTGTTGCATATTTTGGAATCAATTGAATGAAAAGTCGGTTTTTGTTAAGCGATTTCTCTATTTTCCTTCTTAATTTTATATTGTACTCTGTCCAATGGAACTCTGAAGATTGCTTCCTCTTTTGTCTATGGCTTGATGAGTTCATGTAGTCGCGCATTTTTAGCAATTAAAATCGAAATTTTAAATTCTTTTC ATGGGTATTATGAACAGTTTTATCAACGACATTTTCGAGAAGCTCGCTCAGGAATCCTCAAAGCTCGCTCGCTACAACAAAAAGCCGACCATAACCTCTCGGGAGATCCAAACGGCTGTGCGCCTTGTTCTTCCTGGTGAGTTGGCTAAACACGCCGTCTCTGAGGGTACCAAGGCTGTTACCAAGTTTACTAGCTCTTAG MGIMNSFINDIFEKLAQESSKLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
BLAST of MELO3C004868.2 vs. NCBI nr
Match: AAM66958.1 (histone H2B [Arabidopsis thaliana] >OAP15181.1 HTB1 [Arabidopsis thaliana]) HSP 1 Score: 126.7 bits (317), Expect = 2.9e-26 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of MELO3C004868.2 vs. NCBI nr
Match: XP_020868538.1 (histone H2B.1 [Arabidopsis lyrata subsp. lyrata] >EFH65923.1 hypothetical protein ARALYDRAFT_470811 [Arabidopsis lyrata subsp. lyrata]) HSP 1 Score: 126.7 bits (317), Expect = 2.9e-26 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of MELO3C004868.2 vs. NCBI nr
Match: XP_004139453.1 (PREDICTED: histone H2B.7-like [Cucumis sativus] >KGN64858.1 Histone H2B [Cucumis sativus]) HSP 1 Score: 126.7 bits (317), Expect = 2.9e-26 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of MELO3C004868.2 vs. NCBI nr
Match: XP_004143093.1 (PREDICTED: histone H2B [Cucumis sativus] >KGN47176.1 hypothetical protein Csa_6G193620 [Cucumis sativus]) HSP 1 Score: 126.7 bits (317), Expect = 2.9e-26 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of MELO3C004868.2 vs. NCBI nr
Match: XP_011654070.1 (PREDICTED: histone H2B.7 [Cucumis sativus] >XP_011654073.1 PREDICTED: histone H2B.7 [Cucumis sativus] >KGN64852.1 Histone H2B [Cucumis sativus] >KGN64854.1 Histone H2B [Cucumis sativus]) HSP 1 Score: 126.7 bits (317), Expect = 2.9e-26 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of MELO3C004868.2 vs. TAIR10
Match: AT1G07790.1 (Histone superfamily protein) HSP 1 Score: 126.7 bits (317), Expect = 5.2e-30 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of MELO3C004868.2 vs. TAIR10
Match: AT2G37470.1 (Histone superfamily protein) HSP 1 Score: 125.6 bits (314), Expect = 1.2e-29 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 0
BLAST of MELO3C004868.2 vs. TAIR10
Match: AT2G28720.1 (Histone superfamily protein) HSP 1 Score: 125.6 bits (314), Expect = 1.2e-29 Identity = 65/66 (98.48%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of MELO3C004868.2 vs. TAIR10
Match: AT5G02570.1 (Histone superfamily protein) HSP 1 Score: 125.6 bits (314), Expect = 1.2e-29 Identity = 65/66 (98.48%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of MELO3C004868.2 vs. TAIR10
Match: AT5G59910.1 (Histone superfamily protein) HSP 1 Score: 125.6 bits (314), Expect = 1.2e-29 Identity = 65/66 (98.48%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of MELO3C004868.2 vs. Swiss-Prot
Match: sp|Q9LQQ4|H2B1_ARATH (Histone H2B.1 OS=Arabidopsis thaliana OX=3702 GN=At1g07790 PE=1 SV=3) HSP 1 Score: 126.7 bits (317), Expect = 9.5e-29 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of MELO3C004868.2 vs. Swiss-Prot
Match: sp|P40283|H2B11_ARATH (Histone H2B.11 OS=Arabidopsis thaliana OX=3702 GN=At5g59910 PE=1 SV=5) HSP 1 Score: 125.6 bits (314), Expect = 2.1e-28 Identity = 65/66 (98.48%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of MELO3C004868.2 vs. Swiss-Prot
Match: sp|Q1S9I9|H2B1_MEDTR (Probable histone H2B.1 OS=Medicago truncatula OX=3880 PE=3 SV=3) HSP 1 Score: 125.6 bits (314), Expect = 2.1e-28 Identity = 65/66 (98.48%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of MELO3C004868.2 vs. Swiss-Prot
Match: sp|Q9SI96|H2B3_ARATH (Histone H2B.3 OS=Arabidopsis thaliana OX=3702 GN=At2g28720 PE=1 SV=3) HSP 1 Score: 125.6 bits (314), Expect = 2.1e-28 Identity = 65/66 (98.48%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of MELO3C004868.2 vs. Swiss-Prot
Match: sp|Q1SU99|H2B3_MEDTR (Probable histone H2B.3 OS=Medicago truncatula OX=3880 PE=3 SV=3) HSP 1 Score: 125.6 bits (314), Expect = 2.1e-28 Identity = 65/66 (98.48%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of MELO3C004868.2 vs. TrEMBL
Match: tr|A0A2J6K606|A0A2J6K606_LACSA (Histone H2B OS=Lactuca sativa OX=4236 GN=LSAT_1X64820 PE=3 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 1.9e-26 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of MELO3C004868.2 vs. TrEMBL
Match: tr|M5WDD7|M5WDD7_PRUPE (Histone H2B OS=Prunus persica OX=3760 GN=PRUPE_6G082700 PE=3 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 1.9e-26 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of MELO3C004868.2 vs. TrEMBL
Match: tr|M5W0M7|M5W0M7_PRUPE (Histone H2B OS=Prunus persica OX=3760 GN=PRUPE_6G082700 PE=3 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 1.9e-26 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of MELO3C004868.2 vs. TrEMBL
Match: tr|A0A0A0LV55|A0A0A0LV55_CUCSA (Histone H2B OS=Cucumis sativus OX=3659 GN=Csa_1G132130 PE=3 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 1.9e-26 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of MELO3C004868.2 vs. TrEMBL
Match: tr|A0A1J3FK61|A0A1J3FK61_NOCCA (Histone H2B OS=Noccaea caerulescens OX=107243 GN=GA_TR19876_c1_g1_i1_g.65848 PE=3 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 1.9e-26 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|