MELO3C004854.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGATTCAACCTCAAACCCTTTTGAATGTAGCAGATAACAGTGGAGCCCGAGAATTGATGTGTATTCGAATCATAGGGGCTAGTAATAGACGATATGCTCATATTGGTGACATTATTGTTGTTGTAATCAAGAAAGCCGTCCCAAATACACCTCTAGAAATGACACTCACACAATAA ATGATTCAACCTCAAACCCTTTTGAATGTAGCAGATAACAGTGGAGCCCGAGAATTGATGTGTATTCGAATCATAGGGGCTAGTAATAGACGATATGCTCATATTGGTGACATTATTGTTGTTGTAATCAAGAAAGCCGTCCCAAATACACCTCTAGAAATGACACTCACACAATAA ATGATTCAACCTCAAACCCTTTTGAATGTAGCAGATAACAGTGGAGCCCGAGAATTGATGTGTATTCGAATCATAGGGGCTAGTAATAGACGATATGCTCATATTGGTGACATTATTGTTGTTGTAATCAAGAAAGCCGTCCCAAATACACCTCTAGAAATGACACTCACACAATAA MIQPQTLLNVADNSGARELMCIRIIGASNRRYAHIGDIIVVVIKKAVPNTPLEMTLTQ
BLAST of MELO3C004854.2 vs. NCBI nr
Match: YP_009439840.1 (ribosomal protein L14 (chloroplast) [Gynostemma laxiflorum] >ATG86679.1 ribosomal protein L14 (chloroplast) [Gynostemma laxiflorum]) HSP 1 Score: 104.8 bits (260), Expect = 1.0e-19 Identity = 52/53 (98.11%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MELO3C004854.2 vs. NCBI nr
Match: AXR94556.1 (ribosomal protein L14 (chloroplast) [Hodgsonia macrocarpa] >AXR94642.1 ribosomal protein L14 (chloroplast) [Hodgsonia macrocarpa] >AXR94726.1 ribosomal protein L14 (chloroplast) [Hodgsonia macrocarpa] >AXR94811.1 ribosomal protein L14 (chloroplast) [Hodgsonia macrocarpa]) HSP 1 Score: 104.4 bits (259), Expect = 1.4e-19 Identity = 51/53 (96.23%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MELO3C004854.2 vs. NCBI nr
Match: AHM88831.1 (ribosomal protein L14, partial (chloroplast) [Lagenaria siceraria] >AHM91189.1 ribosomal protein L14, partial (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 104.4 bits (259), Expect = 1.4e-19 Identity = 51/53 (96.23%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MELO3C004854.2 vs. NCBI nr
Match: AHM88888.1 (ribosomal protein L14, partial (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 104.4 bits (259), Expect = 1.4e-19 Identity = 51/53 (96.23%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MELO3C004854.2 vs. NCBI nr
Match: AHM91247.1 (ribosomal protein L14, partial (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 104.4 bits (259), Expect = 1.4e-19 Identity = 51/53 (96.23%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MELO3C004854.2 vs. TAIR10
Match: ATCG00780.1 (ribosomal protein L14) HSP 1 Score: 100.5 bits (249), Expect = 3.5e-22 Identity = 48/53 (90.57%), Postives = 51/53 (96.23%), Query Frame = 0
BLAST of MELO3C004854.2 vs. TAIR10
Match: AT5G46160.1 (Ribosomal protein L14p/L23e family protein) HSP 1 Score: 45.4 bits (106), Expect = 1.4e-05 Identity = 22/48 (45.83%), Postives = 34/48 (70.83%), Query Frame = 0
BLAST of MELO3C004854.2 vs. Swiss-Prot
Match: sp|Q8WKP4|RK14_CUCSA (50S ribosomal protein L14, chloroplastic OS=Cucumis sativus OX=3659 GN=rpl14 PE=2 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 4.4e-22 Identity = 51/53 (96.23%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MELO3C004854.2 vs. Swiss-Prot
Match: sp|A4QJF1|RK14_AETCO (50S ribosomal protein L14, chloroplastic OS=Aethionema cordifolium OX=434059 GN=rpl14 PE=3 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 6.4e-21 Identity = 48/53 (90.57%), Postives = 51/53 (96.23%), Query Frame = 0
BLAST of MELO3C004854.2 vs. Swiss-Prot
Match: sp|A4QJN5|RK14_AETGR (50S ribosomal protein L14, chloroplastic OS=Aethionema grandiflorum OX=72657 GN=rpl14 PE=3 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 6.4e-21 Identity = 48/53 (90.57%), Postives = 51/53 (96.23%), Query Frame = 0
BLAST of MELO3C004854.2 vs. Swiss-Prot
Match: sp|P56792|RK14_ARATH (50S ribosomal protein L14, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=rpl14 PE=3 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 6.4e-21 Identity = 48/53 (90.57%), Postives = 51/53 (96.23%), Query Frame = 0
BLAST of MELO3C004854.2 vs. Swiss-Prot
Match: sp|A4QKE1|RK14_BARVE (50S ribosomal protein L14, chloroplastic OS=Barbarea verna OX=50458 GN=rpl14 PE=3 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 6.4e-21 Identity = 48/53 (90.57%), Postives = 51/53 (96.23%), Query Frame = 0
BLAST of MELO3C004854.2 vs. TrEMBL
Match: tr|A0A291IAG3|A0A291IAG3_9ROSI (50S ribosomal protein L14, chloroplastic OS=Gynostemma laxiflorum OX=2041848 GN=rpl14 PE=3 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 6.8e-20 Identity = 52/53 (98.11%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MELO3C004854.2 vs. TrEMBL
Match: tr|X2F235|X2F235_LAGSI (50S ribosomal protein L14, chloroplastic (Fragment) OS=Lagenaria siceraria OX=3668 GN=rpl14 PE=3 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 8.9e-20 Identity = 51/53 (96.23%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MELO3C004854.2 vs. TrEMBL
Match: tr|X2F6Z0|X2F6Z0_LAGSI (50S ribosomal protein L14, chloroplastic OS=Lagenaria siceraria OX=3668 GN=rpl14 PE=3 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 8.9e-20 Identity = 51/53 (96.23%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MELO3C004854.2 vs. TrEMBL
Match: tr|A0A286NG04|A0A286NG04_CUCME (50S ribosomal protein L14, chloroplastic OS=Cucumis melo var. flexuosus OX=1120798 GN=rpl14 PE=3 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 8.9e-20 Identity = 51/53 (96.23%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of MELO3C004854.2 vs. TrEMBL
Match: tr|A0A249RY33|A0A249RY33_CUCME (50S ribosomal protein L14, chloroplastic OS=Cucumis melo subsp. agrestis OX=217619 GN=rpl14 PE=3 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 8.9e-20 Identity = 51/53 (96.23%), Postives = 52/53 (98.11%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|