MELO3C004696.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGAAGATGCCTCTGAAATTTTTTTTTTTAATTTCTAATCCTCCGATTCAATCACCGCAGTGGGAAGAAGACGTCGTAACCTATCTCGTCGCCGCACCCTACCTTGTCATCTTCTCCTCATTCGTCTCCATTTTTCCACTGCAGTCGACGCACGATAAATCCCCAGATGCCACCATCGCGGTTGGCACAATGGGTTACGAAGCACCAGAATATCTCCTCATTGGACGAGCTACGAAAAAAACTGATATGTTTAGCTTCGGCGTCATCGTTCTTGAAAAGTCACTAGCGCAAACGACCGATTGA ATGGAGAAGATGCCTCTGAAATTTTTTTTTTTAATTTCTAATCCTCCGATTCAATCACCGCAGTGGGAAGAAGACGTCGTAACCTATCTCGTCGCCGCACCCTACCTTGTCATCTTCTCCTCATTCGTCTCCATTTTTCCACTGCAGTCGACGCACGATAAATCCCCAGATGCCACCATCGCGGTTGGCACAATGGGTTACGAAGCACCAGAATATCTCCTCATTGGACGAGCTACGAAAAAAACTGATATGTTTAGCTTCGGCGTCATCGTTCTTGAAAAGTCACTAGCGCAAACGACCGATTGA ATGGAGAAGATGCCTCTGAAATTTTTTTTTTTAATTTCTAATCCTCCGATTCAATCACCGCAGTGGGAAGAAGACGTCGTAACCTATCTCGTCGCCGCACCCTACCTTGTCATCTTCTCCTCATTCGTCTCCATTTTTCCACTGCAGTCGACGCACGATAAATCCCCAGATGCCACCATCGCGGTTGGCACAATGGGTTACGAAGCACCAGAATATCTCCTCATTGGACGAGCTACGAAAAAAACTGATATGTTTAGCTTCGGCGTCATCGTTCTTGAAAAGTCACTAGCGCAAACGACCGATTGA MEKMPLKFFFLISNPPIQSPQWEEDVVTYLVAAPYLVIFSSFVSIFPLQSTHDKSPDATIAVGTMGYEAPEYLLIGRATKKTDMFSFGVIVLEKSLAQTTD
BLAST of MELO3C004696.2 vs. NCBI nr
Match: XP_004137813.1 (PREDICTED: L-type lectin-domain containing receptor kinase VIII.1 [Cucumis sativus] >KGN58949.1 Lectin receptor kinase-like protein [Cucumis sativus]) HSP 1 Score: 77.4 bits (189), Expect = 3.1e-11 Identity = 35/45 (77.78%), Postives = 39/45 (86.67%), Query Frame = 0
BLAST of MELO3C004696.2 vs. NCBI nr
Match: XP_008363824.1 (PREDICTED: L-type lectin-domain containing receptor kinase VIII.1-like [Malus domestica]) HSP 1 Score: 77.4 bits (189), Expect = 3.1e-11 Identity = 35/45 (77.78%), Postives = 39/45 (86.67%), Query Frame = 0
BLAST of MELO3C004696.2 vs. NCBI nr
Match: XP_008442670.1 (PREDICTED: L-type lectin-domain containing receptor kinase VIII.1 [Cucumis melo]) HSP 1 Score: 77.4 bits (189), Expect = 3.1e-11 Identity = 35/45 (77.78%), Postives = 39/45 (86.67%), Query Frame = 0
BLAST of MELO3C004696.2 vs. NCBI nr
Match: KZV51757.1 (L-type lectin-domain containing receptor kinase VIII.1 [Dorcoceras hygrometricum]) HSP 1 Score: 77.4 bits (189), Expect = 3.1e-11 Identity = 35/45 (77.78%), Postives = 39/45 (86.67%), Query Frame = 0
BLAST of MELO3C004696.2 vs. NCBI nr
Match: XP_022888596.1 (L-type lectin-domain containing receptor kinase VIII.1-like [Olea europaea var. sylvestris]) HSP 1 Score: 77.4 bits (189), Expect = 3.1e-11 Identity = 34/45 (75.56%), Postives = 40/45 (88.89%), Query Frame = 0
BLAST of MELO3C004696.2 vs. TAIR10
Match: AT5G03140.1 (Concanavalin A-like lectin protein kinase family protein) HSP 1 Score: 75.9 bits (185), Expect = 1.6e-14 Identity = 34/45 (75.56%), Postives = 39/45 (86.67%), Query Frame = 0
BLAST of MELO3C004696.2 vs. TAIR10
Match: AT3G53380.1 (Concanavalin A-like lectin protein kinase family protein) HSP 1 Score: 73.2 bits (178), Expect = 1.1e-13 Identity = 32/45 (71.11%), Postives = 39/45 (86.67%), Query Frame = 0
BLAST of MELO3C004696.2 vs. TAIR10
Match: AT5G55830.1 (Concanavalin A-like lectin protein kinase family protein) HSP 1 Score: 64.3 bits (155), Expect = 4.9e-11 Identity = 28/42 (66.67%), Postives = 34/42 (80.95%), Query Frame = 0
BLAST of MELO3C004696.2 vs. TAIR10
Match: AT5G10530.1 (Concanavalin A-like lectin protein kinase family protein) HSP 1 Score: 55.5 bits (132), Expect = 2.3e-08 Identity = 31/78 (39.74%), Postives = 47/78 (60.26%), Query Frame = 0
BLAST of MELO3C004696.2 vs. TAIR10
Match: AT1G31420.1 (Leucine-rich repeat protein kinase family protein) HSP 1 Score: 55.1 bits (131), Expect = 3.0e-08 Identity = 25/41 (60.98%), Postives = 32/41 (78.05%), Query Frame = 0
BLAST of MELO3C004696.2 vs. Swiss-Prot
Match: sp|Q9LYX1|LRK82_ARATH (L-type lectin-domain containing receptor kinase VIII.2 OS=Arabidopsis thaliana OX=3702 GN=LECRK82 PE=2 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 2.9e-13 Identity = 34/45 (75.56%), Postives = 39/45 (86.67%), Query Frame = 0
BLAST of MELO3C004696.2 vs. Swiss-Prot
Match: sp|Q9LFH9|LRK81_ARATH (L-type lectin-domain containing receptor kinase VIII.1 OS=Arabidopsis thaliana OX=3702 GN=LECRK81 PE=2 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.9e-12 Identity = 32/45 (71.11%), Postives = 39/45 (86.67%), Query Frame = 0
BLAST of MELO3C004696.2 vs. Swiss-Prot
Match: sp|Q9FHG4|LRKS7_ARATH (Probable L-type lectin-domain containing receptor kinase S.7 OS=Arabidopsis thaliana OX=3702 GN=LECRKS7 PE=2 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 8.8e-10 Identity = 28/42 (66.67%), Postives = 34/42 (80.95%), Query Frame = 0
BLAST of MELO3C004696.2 vs. Swiss-Prot
Match: sp|Q9LXA5|LRK91_ARATH (L-type lectin-domain containing receptor kinase IX.1 OS=Arabidopsis thaliana OX=3702 GN=LECRK91 PE=1 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 4.1e-07 Identity = 31/78 (39.74%), Postives = 47/78 (60.26%), Query Frame = 0
BLAST of MELO3C004696.2 vs. Swiss-Prot
Match: sp|C0LGF4|FEI1_ARATH (LRR receptor-like serine/threonine-protein kinase FEI 1 OS=Arabidopsis thaliana OX=3702 GN=FEI1 PE=1 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 5.4e-07 Identity = 25/41 (60.98%), Postives = 32/41 (78.05%), Query Frame = 0
BLAST of MELO3C004696.2 vs. TrEMBL
Match: tr|A0A1S3B5R3|A0A1S3B5R3_CUCME (L-type lectin-domain containing receptor kinase VIII.1 OS=Cucumis melo OX=3656 GN=LOC103486472 PE=4 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 2.0e-11 Identity = 35/45 (77.78%), Postives = 39/45 (86.67%), Query Frame = 0
BLAST of MELO3C004696.2 vs. TrEMBL
Match: tr|A0A0A0LDF8|A0A0A0LDF8_CUCSA (Lectin receptor kinase-like protein OS=Cucumis sativus OX=3659 GN=Csa_3G736960 PE=4 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 2.0e-11 Identity = 35/45 (77.78%), Postives = 39/45 (86.67%), Query Frame = 0
BLAST of MELO3C004696.2 vs. TrEMBL
Match: tr|A0A200R5Z2|A0A200R5Z2_9MAGN (Protein kinase domain OS=Macleaya cordata OX=56857 GN=BVC80_1835g528 PE=4 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 2.7e-11 Identity = 36/45 (80.00%), Postives = 38/45 (84.44%), Query Frame = 0
BLAST of MELO3C004696.2 vs. TrEMBL
Match: tr|A0A2G5D508|A0A2G5D508_AQUCA (Uncharacterized protein OS=Aquilegia coerulea OX=218851 GN=AQUCO_02700072v1 PE=4 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 2.7e-11 Identity = 34/45 (75.56%), Postives = 40/45 (88.89%), Query Frame = 0
BLAST of MELO3C004696.2 vs. TrEMBL
Match: tr|A0A087G4G4|A0A087G4G4_ARAAL (Uncharacterized protein OS=Arabis alpina OX=50452 GN=AALP_AA8G022200 PE=4 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 2.7e-11 Identity = 34/47 (72.34%), Postives = 41/47 (87.23%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|