MELO3C004017 (gene) Melon (DHL92) v3.5.1

NameMELO3C004017
Typegene
OrganismCucumis melo (Melon (DHL92) v3.5.1)
DescriptionNuclear RNA export factor 1
Locationchr5 : 21728352 .. 21728537 (+)
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGGACTTGATTGATCCACGGTACCATGGACGTGCAACTGCTATAAACAATCAAAGAATATCGGTGCATAAAACAATGGCAGTCCATAAACCAAAGGCGGCGGCGGCGCGTGGAGGTGCGGCTAATCAGAAGGGTATTGCAGCTGGACTTGGGAAGACAGGTGGGAGTACATCGGCTAAGCAGTAG

mRNA sequence

ATGGACTTGATTGATCCACGGTACCATGGACGTGCAACTGCTATAAACAATCAAAGAATATCGGTGCATAAAACAATGGCAGTCCATAAACCAAAGGCGGCGGCGGCGCGTGGAGGTGCGGCTAATCAGAAGGGTATTGCAGCTGGACTTGGGAAGACAGGTGGGAGTACATCGGCTAAGCAGTAG

Coding sequence (CDS)

ATGGACTTGATTGATCCACGGTACCATGGACGTGCAACTGCTATAAACAATCAAAGAATATCGGTGCATAAAACAATGGCAGTCCATAAACCAAAGGCGGCGGCGGCGCGTGGAGGTGCGGCTAATCAGAAGGGTATTGCAGCTGGACTTGGGAAGACAGGTGGGAGTACATCGGCTAAGCAGTAG

Protein sequence

MDLIDPRYHGRATAINNQRISVHKTMAVHKPKAAAARGGAANQKGIAAGLGKTGGSTSAKQ*
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008150 biological_process
cellular_component GO:0005575 cellular_component
molecular_function GO:0003674 molecular_function
This gene is associated with the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
MU48699melon EST collection version 4.0transcribed_cluster

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
MELO3C004017T1MELO3C004017T1mRNA


The following transcribed_cluster feature(s) are associated with this gene:

Feature NameUnique NameType
MU48699MU48699transcribed_cluster


The following gene(s) are orthologous to this gene:

None

The following gene(s) are paralogous to this gene:

None

The following block(s) are covering this gene:
GeneOrganismBlock
MELO3C004017Cucurbita maxima (Rimu)cmameB075
MELO3C004017Cucurbita maxima (Rimu)cmameB175
MELO3C004017Cucurbita maxima (Rimu)cmameB737
MELO3C004017Cucurbita moschata (Rifu)cmomeB068
MELO3C004017Cucurbita moschata (Rifu)cmomeB164
MELO3C004017Cucurbita moschata (Rifu)cmomeB725
MELO3C004017Wild cucumber (PI 183967)cpimeB074
MELO3C004017Wild cucumber (PI 183967)cpimeB139
MELO3C004017Cucumber (Chinese Long) v2cumeB075
MELO3C004017Cucumber (Chinese Long) v2cumeB139
MELO3C004017Watermelon (Charleston Gray)mewcgB367
MELO3C004017Watermelon (Charleston Gray)mewcgB397
MELO3C004017Watermelon (97103) v1mewmB422
MELO3C004017Watermelon (97103) v1mewmB440
MELO3C004017Cucurbita pepo (Zucchini)cpemeB100
MELO3C004017Cucurbita pepo (Zucchini)cpemeB103
MELO3C004017Cucurbita pepo (Zucchini)cpemeB344
MELO3C004017Cucurbita pepo (Zucchini)cpemeB777
MELO3C004017Bottle gourd (USVL1VR-Ls)lsimeB115
MELO3C004017Bottle gourd (USVL1VR-Ls)lsimeB419
MELO3C004017Cucumber (Gy14) v2cgybmeB067
MELO3C004017Cucumber (Gy14) v2cgybmeB120
MELO3C004017Silver-seed gourdcarmeB0062
MELO3C004017Silver-seed gourdcarmeB0786
MELO3C004017Silver-seed gourdcarmeB0970
MELO3C004017Cucumber (Chinese Long) v3cucmeB080
MELO3C004017Cucumber (Chinese Long) v3cucmeB141
MELO3C004017Watermelon (97103) v2mewmbB369
MELO3C004017Watermelon (97103) v2mewmbB399
MELO3C004017Wax gourdmewgoB453
MELO3C004017Wax gourdmewgoB492
MELO3C004017Melon (DHL92) v3.5.1memeB110
MELO3C004017Cucumber (Gy14) v1cgymeB088
MELO3C004017Cucumber (Gy14) v1cgymeB105