MELO3C003855 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATTTTTTTTTTCTCCTTAAGGCTCTTGACAGAGGTGTTGCATTGTTGAAAGTAGTCAAGCTAGCCACAGGGCACAATGCAATTGATATGGTTGGAACAATTCTATTAAATATATTACGAGGTGATATTCCAAGGTATTTTAATAGTAAGACTTTTTATTTCTGTCAATTACTTTTGTCCCTCATTTGGGTTGTATTAGACTGAAGTGATGCTTTGTATTTGTAGATTGAGTAGATGTACTGCATTAATTACCGACGAAGATGGACCAAATCCAAGATGCTAA ATGGATTTTTTTTTTCTCCTTAAGGCTCTTGACAGAGGTGTTGCATTGTTGAAAGTAGTCAAGCTAGCCACAGGGCACAATGCAATTGATATGGTTGGAACAATTCTATTAAATATATTACGAGGTGATATTCCAAGATTGAGTAGATGTACTGCATTAATTACCGACGAAGATGGACCAAATCCAAGATGCTAA ATGGATTTTTTTTTTCTCCTTAAGGCTCTTGACAGAGGTGTTGCATTGTTGAAAGTAGTCAAGCTAGCCACAGGGCACAATGCAATTGATATGGTTGGAACAATTCTATTAAATATATTACGAGGTGATATTCCAAGATTGAGTAGATGTACTGCATTAATTACCGACGAAGATGGACCAAATCCAAGATGCTAA MDFFFLLKALDRGVALLKVVKLATGHNAIDMVGTILLNILRGDIPRLSRCTALITDEDGPNPRC*
BLAST of MELO3C003855 vs. Swiss-Prot
Match: CTU1_ARATH (Cytoplasmic tRNA 2-thiolation protein 1 OS=Arabidopsis thaliana GN=NCS6 PE=2 SV=2) HSP 1 Score: 88.2 bits (217), Expect = 3.6e-17 Identity = 43/60 (71.67%), Postives = 46/60 (76.67%), Query Frame = 1
BLAST of MELO3C003855 vs. Swiss-Prot
Match: CTU1_ORYSJ (Cytoplasmic tRNA 2-thiolation protein 1 OS=Oryza sativa subsp. japonica GN=NCS6 PE=2 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 1.8e-16 Identity = 42/60 (70.00%), Postives = 45/60 (75.00%), Query Frame = 1
BLAST of MELO3C003855 vs. Swiss-Prot
Match: CTU1_CHLRE (Cytoplasmic tRNA 2-thiolation protein 1 OS=Chlamydomonas reinhardtii GN=NCS6 PE=3 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.2e-12 Identity = 35/59 (59.32%), Postives = 40/59 (67.80%), Query Frame = 1
BLAST of MELO3C003855 vs. Swiss-Prot
Match: CTU1_DICDI (Cytoplasmic tRNA 2-thiolation protein 1 OS=Dictyostelium discoideum GN=ctu1 PE=2 SV=2) HSP 1 Score: 72.0 bits (175), Expect = 2.7e-12 Identity = 33/59 (55.93%), Postives = 40/59 (67.80%), Query Frame = 1
BLAST of MELO3C003855 vs. Swiss-Prot
Match: CTU1_XENLA (Cytoplasmic tRNA 2-thiolation protein 1 OS=Xenopus laevis GN=ctu1 PE=2 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 3.5e-12 Identity = 33/60 (55.00%), Postives = 40/60 (66.67%), Query Frame = 1
BLAST of MELO3C003855 vs. TrEMBL
Match: A0A0A0LKF0_CUCSA (Cytoplasmic tRNA 2-thiolation protein 1 OS=Cucumis sativus GN=NCS6 PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 7.3e-17 Identity = 47/60 (78.33%), Postives = 50/60 (83.33%), Query Frame = 1
BLAST of MELO3C003855 vs. TrEMBL
Match: A0A0D3D124_BRAOL (Uncharacterized protein OS=Brassica oleracea var. oleracea PE=4 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 9.6e-17 Identity = 45/62 (72.58%), Postives = 50/62 (80.65%), Query Frame = 1
BLAST of MELO3C003855 vs. TrEMBL
Match: A0A103XR73_CYNCS (Rossmann-like alpha/beta/alpha sandwich fold (Fragment) OS=Cynara cardunculus var. scolymus GN=Ccrd_002507 PE=4 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 4.8e-16 Identity = 45/60 (75.00%), Postives = 50/60 (83.33%), Query Frame = 1
BLAST of MELO3C003855 vs. TrEMBL
Match: M5XB75_PRUPE (Cytoplasmic tRNA 2-thiolation protein 1 OS=Prunus persica GN=NCS6 PE=3 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 6.2e-16 Identity = 44/60 (73.33%), Postives = 50/60 (83.33%), Query Frame = 1
BLAST of MELO3C003855 vs. TrEMBL
Match: E0CQT4_VITVI (Cytoplasmic tRNA 2-thiolation protein 1 OS=Vitis vinifera GN=NCS6 PE=3 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 8.1e-16 Identity = 44/60 (73.33%), Postives = 50/60 (83.33%), Query Frame = 1
BLAST of MELO3C003855 vs. TAIR10
Match: AT2G44270.2 (AT2G44270.2 repressor of lrx1) HSP 1 Score: 88.2 bits (217), Expect = 2.0e-18 Identity = 43/60 (71.67%), Postives = 46/60 (76.67%), Query Frame = 1
BLAST of MELO3C003855 vs. TAIR10
Match: AT1G76170.1 (AT1G76170.1 2-thiocytidine tRNA biosynthesis protein, TtcA) HSP 1 Score: 86.7 bits (213), Expect = 5.9e-18 Identity = 42/60 (70.00%), Postives = 46/60 (76.67%), Query Frame = 1
BLAST of MELO3C003855 vs. NCBI nr
Match: gi|659093684|ref|XP_008447661.1| (PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like [Cucumis melo]) HSP 1 Score: 101.7 bits (252), Expect = 5.0e-19 Identity = 51/56 (91.07%), Postives = 52/56 (92.86%), Query Frame = 1
BLAST of MELO3C003855 vs. NCBI nr
Match: gi|778670437|ref|XP_011649473.1| (PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Cucumis sativus]) HSP 1 Score: 94.0 bits (232), Expect = 1.1e-16 Identity = 47/60 (78.33%), Postives = 50/60 (83.33%), Query Frame = 1
BLAST of MELO3C003855 vs. NCBI nr
Match: gi|659089053|ref|XP_008445303.1| (PREDICTED: cytoplasmic tRNA 2-thiolation protein 1 [Cucumis melo]) HSP 1 Score: 91.7 bits (226), Expect = 5.2e-16 Identity = 46/60 (76.67%), Postives = 49/60 (81.67%), Query Frame = 1
BLAST of MELO3C003855 vs. NCBI nr
Match: gi|976908178|gb|KVH95408.1| (Rossmann-like alpha/beta/alpha sandwich fold, partial [Cynara cardunculus var. scolymus]) HSP 1 Score: 91.3 bits (225), Expect = 6.8e-16 Identity = 45/60 (75.00%), Postives = 50/60 (83.33%), Query Frame = 1
BLAST of MELO3C003855 vs. NCBI nr
Match: gi|596130726|ref|XP_007222158.1| (hypothetical protein PRUPE_ppa007715mg [Prunus persica]) HSP 1 Score: 90.9 bits (224), Expect = 8.9e-16 Identity = 44/60 (73.33%), Postives = 50/60 (83.33%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |