MELO3C003843 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.GTTTATGCAGTTCACTTCAAGTGCAACAAGAAACTACTGAGAGAGTATTCAAATCTGTTCGATTACACCAAAGATATATACCAAACTAAAGGGGTAGACAGCTCTGTTAATATGGAACATATAAAGAAGCATTATTATGGAAGCCATCCTACAATCAATCCATTTGGAATGATCCCTCTTGGCCCAAATATTGATTACTCTTCTCCTCGTGATTATAGATAG GTTTATGCAGTTCACTTCAAGTGCAACAAGAAACTACTGAGAGAGTATTCAAATCTGTTCGATTACACCAAAGATATATACCAAACTAAAGGGGTAGACAGCTCTGTTAATATGGAACATATAAAGAAGCATTATTATGGAAGCCATCCTACAATCAATCCATTTGGAATGATCCCTCTTGGCCCAAATATTGATTACTCTTCTCCTCGTGATTATAGATAG GTTTATGCAGTTCACTTCAAGTGCAACAAGAAACTACTGAGAGAGTATTCAAATCTGTTCGATTACACCAAAGATATATACCAAACTAAAGGGGTAGACAGCTCTGTTAATATGGAACATATAAAGAAGCATTATTATGGAAGCCATCCTACAATCAATCCATTTGGAATGATCCCTCTTGGCCCAAATATTGATTACTCTTCTCCTCGTGATTATAGATAG VYAVHFKCNKKLLREYSNLFDYTKDIYQTKGVDSSVNMEHIKKHYYGSHPTINPFGMIPLGPNIDYSSPRDYR*
BLAST of MELO3C003843 vs. Swiss-Prot
Match: YQJG_ECOLI (Glutathionyl-hydroquinone reductase YqjG OS=Escherichia coli (strain K12) GN=yqjG PE=1 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 5.0e-15 Identity = 36/75 (48.00%), Postives = 48/75 (64.00%), Query Frame = 1
BLAST of MELO3C003843 vs. TrEMBL
Match: A0A0A0M0U0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G701990 PE=4 SV=1) HSP 1 Score: 147.5 bits (371), Expect = 6.4e-33 Identity = 67/71 (94.37%), Postives = 69/71 (97.18%), Query Frame = 1
BLAST of MELO3C003843 vs. TrEMBL
Match: A0A068URV3_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00033358001 PE=4 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 1.6e-28 Identity = 59/71 (83.10%), Postives = 65/71 (91.55%), Query Frame = 1
BLAST of MELO3C003843 vs. TrEMBL
Match: M1ANN8_SOLTU (Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400010333 PE=4 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 2.1e-28 Identity = 59/71 (83.10%), Postives = 64/71 (90.14%), Query Frame = 1
BLAST of MELO3C003843 vs. TrEMBL
Match: A0A0V0I3X2_SOLCH (Putative glutathione S-transferase omega-like 2-like OS=Solanum chacoense PE=4 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 2.1e-28 Identity = 59/71 (83.10%), Postives = 64/71 (90.14%), Query Frame = 1
BLAST of MELO3C003843 vs. TrEMBL
Match: A0A0U4J960_LITCN (GST8 OS=Litchi chinensis PE=2 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 2.8e-28 Identity = 57/71 (80.28%), Postives = 66/71 (92.96%), Query Frame = 1
BLAST of MELO3C003843 vs. TAIR10
Match: AT5G45020.1 (AT5G45020.1 Glutathione S-transferase family protein) HSP 1 Score: 130.6 bits (327), Expect = 4.1e-31 Identity = 57/71 (80.28%), Postives = 62/71 (87.32%), Query Frame = 1
BLAST of MELO3C003843 vs. TAIR10
Match: AT4G19880.2 (AT4G19880.2 Glutathione S-transferase family protein) HSP 1 Score: 127.9 bits (320), Expect = 2.6e-30 Identity = 55/71 (77.46%), Postives = 62/71 (87.32%), Query Frame = 1
BLAST of MELO3C003843 vs. TAIR10
Match: AT5G44990.1 (AT5G44990.1 Glutathione S-transferase family protein) HSP 1 Score: 100.5 bits (249), Expect = 4.5e-22 Identity = 45/70 (64.29%), Postives = 55/70 (78.57%), Query Frame = 1
BLAST of MELO3C003843 vs. TAIR10
Match: AT5G44000.1 (AT5G44000.1 Glutathione S-transferase family protein) HSP 1 Score: 49.3 bits (116), Expect = 1.2e-06 Identity = 27/71 (38.03%), Postives = 36/71 (50.70%), Query Frame = 1
BLAST of MELO3C003843 vs. NCBI nr
Match: gi|449455407|ref|XP_004145444.1| (PREDICTED: glutathione S-transferase omega-like 2 [Cucumis sativus]) HSP 1 Score: 147.5 bits (371), Expect = 9.1e-33 Identity = 67/71 (94.37%), Postives = 69/71 (97.18%), Query Frame = 1
BLAST of MELO3C003843 vs. NCBI nr
Match: gi|659118292|ref|XP_008459045.1| (PREDICTED: glutathione S-transferase omega-like 2 isoform X2 [Cucumis melo]) HSP 1 Score: 147.5 bits (371), Expect = 9.1e-33 Identity = 67/71 (94.37%), Postives = 69/71 (97.18%), Query Frame = 1
BLAST of MELO3C003843 vs. NCBI nr
Match: gi|659118290|ref|XP_008459044.1| (PREDICTED: glutathione S-transferase omega-like 2 isoform X1 [Cucumis melo]) HSP 1 Score: 147.5 bits (371), Expect = 9.1e-33 Identity = 67/71 (94.37%), Postives = 69/71 (97.18%), Query Frame = 1
BLAST of MELO3C003843 vs. NCBI nr
Match: gi|743771606|ref|XP_010916094.1| (PREDICTED: LOW QUALITY PROTEIN: glutathione S-transferase omega-like 2 [Elaeis guineensis]) HSP 1 Score: 134.8 bits (338), Expect = 6.1e-29 Identity = 60/71 (84.51%), Postives = 65/71 (91.55%), Query Frame = 1
BLAST of MELO3C003843 vs. NCBI nr
Match: gi|727648014|ref|XP_010494562.1| (PREDICTED: glutathione S-transferase omega-like 2 [Camelina sativa]) HSP 1 Score: 132.9 bits (333), Expect = 2.3e-28 Identity = 58/71 (81.69%), Postives = 65/71 (91.55%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |