MELO3C003723 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACGTCAATGTTGAGAGGGCTCAAGACGTTCTCATGCACAAAAATCTTCTCTACATGGCACGTGATCCTGATACTCGACCTGCAATTGACGTTCGTCTTGTACAGGTAATGTCTATCACGAACTATTGATTATTGCACTAGATTTTCATATGACAGAAGTAATGGAATTTCCTCTTACATCTCTTGCTATTTATGTGATTAAGTAGTTTCTTTTAGTGCACTTTTGTTGTTTTATTTGCCTGAAGAGTATTTTTCATTTAACTTTCCCAGTGTTCTAAAAGTTAACCTTTATACATTCTGTATTAGAATTCTATCTTGTTCTTACCGAAAAAATGCAAATGTAAAAATTGGTCACCTTGCAGGTTCATTCATCTCCTGGCAGGAACTTTGGCAAGTCAGTTAATTGGAGCTTGAAGGAAAAAGTGGACCAGGAGCGGTTTTCTGGTTATGACAGCAATCAGAGGCAGGGTTAA ATGGACGTCAATGTTGAGAGGGCTCAAGACGTTCTCATGCACAAAAATCTTCTCTACATGGCACGTGATCCTGATACTCGACCTGCAATTGACGTTCGTCTTGTACAGGTTCATTCATCTCCTGGCAGGAACTTTGGCAAGTCAGTTAATTGGAGCTTGAAGGAAAAAGTGGACCAGGAGCGGTTTTCTGGTTATGACAGCAATCAGAGGCAGGGTTAA ATGGACGTCAATGTTGAGAGGGCTCAAGACGTTCTCATGCACAAAAATCTTCTCTACATGGCACGTGATCCTGATACTCGACCTGCAATTGACGTTCGTCTTGTACAGGTTCATTCATCTCCTGGCAGGAACTTTGGCAAGTCAGTTAATTGGAGCTTGAAGGAAAAAGTGGACCAGGAGCGGTTTTCTGGTTATGACAGCAATCAGAGGCAGGGTTAA MDVNVERAQDVLMHKNLLYMARDPDTRPAIDVRLVQVHSSPGRNFGKSVNWSLKEKVDQERFSGYDSNQRQG*
BLAST of MELO3C003723 vs. Swiss-Prot
Match: STY46_ARATH (Serine/threonine-protein kinase STY46 OS=Arabidopsis thaliana GN=STY46 PE=1 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 7.7e-08 Identity = 27/37 (72.97%), Postives = 29/37 (78.38%), Query Frame = 1
BLAST of MELO3C003723 vs. Swiss-Prot
Match: STY17_ARATH (Serine/threonine-protein kinase STY17 OS=Arabidopsis thaliana GN=STY17 PE=1 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.1e-06 Identity = 26/46 (56.52%), Postives = 30/46 (65.22%), Query Frame = 1
BLAST of MELO3C003723 vs. TrEMBL
Match: A0A061FDQ8_THECC (ACT-like protein tyrosine kinase family protein isoform 1 OS=Theobroma cacao GN=TCM_034314 PE=4 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.3e-09 Identity = 39/69 (56.52%), Postives = 47/69 (68.12%), Query Frame = 1
BLAST of MELO3C003723 vs. TrEMBL
Match: A0A061FEQ5_THECC (ACT-like protein tyrosine kinase family protein isoform 2 OS=Theobroma cacao GN=TCM_034314 PE=4 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.3e-09 Identity = 39/69 (56.52%), Postives = 47/69 (68.12%), Query Frame = 1
BLAST of MELO3C003723 vs. TrEMBL
Match: A0A068U2J7_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00037004001 PE=4 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 4.8e-09 Identity = 37/70 (52.86%), Postives = 46/70 (65.71%), Query Frame = 1
BLAST of MELO3C003723 vs. TrEMBL
Match: E0CQV3_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_18s0001g00720 PE=4 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 6.3e-09 Identity = 38/70 (54.29%), Postives = 48/70 (68.57%), Query Frame = 1
BLAST of MELO3C003723 vs. TrEMBL
Match: I1J8F7_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_01G161600 PE=3 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 8.3e-09 Identity = 34/69 (49.28%), Postives = 43/69 (62.32%), Query Frame = 1
BLAST of MELO3C003723 vs. TAIR10
Match: AT4G38470.1 (AT4G38470.1 ACT-like protein tyrosine kinase family protein) HSP 1 Score: 57.4 bits (137), Expect = 4.3e-09 Identity = 27/37 (72.97%), Postives = 29/37 (78.38%), Query Frame = 1
BLAST of MELO3C003723 vs. TAIR10
Match: AT4G35780.1 (AT4G35780.1 ACT-like protein tyrosine kinase family protein) HSP 1 Score: 53.5 bits (127), Expect = 6.2e-08 Identity = 26/46 (56.52%), Postives = 30/46 (65.22%), Query Frame = 1
BLAST of MELO3C003723 vs. TAIR10
Match: AT2G17700.1 (AT2G17700.1 ACT-like protein tyrosine kinase family protein) HSP 1 Score: 48.9 bits (115), Expect = 1.5e-06 Identity = 23/37 (62.16%), Postives = 26/37 (70.27%), Query Frame = 1
BLAST of MELO3C003723 vs. NCBI nr
Match: gi|659132907|ref|XP_008466449.1| (PREDICTED: ephrin type-B receptor 3-like isoform X3 [Cucumis melo]) HSP 1 Score: 145.6 bits (366), Expect = 3.4e-32 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 1
BLAST of MELO3C003723 vs. NCBI nr
Match: gi|659132903|ref|XP_008466447.1| (PREDICTED: tyrosine-protein kinase Abl-like isoform X2 [Cucumis melo]) HSP 1 Score: 145.6 bits (366), Expect = 3.4e-32 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 1
BLAST of MELO3C003723 vs. NCBI nr
Match: gi|659132900|ref|XP_008466446.1| (PREDICTED: tyrosine-protein kinase Abl-like isoform X1 [Cucumis melo]) HSP 1 Score: 145.6 bits (366), Expect = 3.4e-32 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 1
BLAST of MELO3C003723 vs. NCBI nr
Match: gi|659132909|ref|XP_008466450.1| (PREDICTED: serine/threonine-protein kinase HT1-like isoform X4 [Cucumis melo]) HSP 1 Score: 145.6 bits (366), Expect = 3.4e-32 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 1
BLAST of MELO3C003723 vs. NCBI nr
Match: gi|764540728|ref|XP_011459088.1| (PREDICTED: probable serine/threonine-protein kinase DDB_G0267514 isoform X2 [Fragaria vesca subsp. vesca]) HSP 1 Score: 74.7 bits (182), Expect = 7.4e-11 Identity = 35/50 (70.00%), Postives = 41/50 (82.00%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|