MELO3C003510 (gene) Melon (DHL92) v3.5.1

NameMELO3C003510
Typegene
OrganismCucumis melo (Melon (DHL92) v3.5.1)
DescriptionDNA-directed RNA polymerase subunit beta
Locationchr4 : 1849270 .. 1849452 (+)
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGACACTGGCAGCGGGATCTGTAACGGAATGGACAAACAGGAATGTGGTGAGGAGGCAAAAGCCGATGGTTAGAGAAAGAACCAAGAGAACAGAGGCCAAGAATTACCGGCGAGGCTTCGTACAGACCGATGAGCGGCTAAACGGCAGCTGGAGTTGGACGAAGTGCACGATAGACAGGTGA

mRNA sequence

ATGACACTGGCAGCGGGATCTGTAACGGAATGGACAAACAGGAATGTGGTGAGGAGGCAAAAGCCGATGGTTAGAGAAAGAACCAAGAGAACAGAGGCCAAGAATTACCGGCGAGGCTTCGTACAGACCGATGAGCGGCTAAACGGCAGCTGGAGTTGGACGAAGTGCACGATAGACAGGTGA

Coding sequence (CDS)

ATGACACTGGCAGCGGGATCTGTAACGGAATGGACAAACAGGAATGTGGTGAGGAGGCAAAAGCCGATGGTTAGAGAAAGAACCAAGAGAACAGAGGCCAAGAATTACCGGCGAGGCTTCGTACAGACCGATGAGCGGCTAAACGGCAGCTGGAGTTGGACGAAGTGCACGATAGACAGGTGA

Protein sequence

MTLAAGSVTEWTNRNVVRRQKPMVRERTKRTEAKNYRRGFVQTDERLNGSWSWTKCTIDR*
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008150 biological_process
cellular_component GO:0005575 cellular_component
molecular_function GO:0003674 molecular_function
This gene is associated with the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
MU53879melon EST collection version 4.0transcribed_cluster

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
MELO3C003510T1MELO3C003510T1mRNA


The following transcribed_cluster feature(s) are associated with this gene:

Feature NameUnique NameType
MU53879MU53879transcribed_cluster


The following gene(s) are orthologous to this gene:

None

The following gene(s) are paralogous to this gene:

None

The following block(s) are covering this gene:
GeneOrganismBlock
MELO3C003510Cucurbita maxima (Rimu)cmameB034
MELO3C003510Cucurbita maxima (Rimu)cmameB170
MELO3C003510Cucurbita maxima (Rimu)cmameB417
MELO3C003510Cucurbita moschata (Rifu)cmomeB023
MELO3C003510Cucurbita moschata (Rifu)cmomeB159
MELO3C003510Cucurbita moschata (Rifu)cmomeB407
MELO3C003510Wild cucumber (PI 183967)cpimeB125
MELO3C003510Wild cucumber (PI 183967)cpimeB215
MELO3C003510Wild cucumber (PI 183967)cpimeB483
MELO3C003510Cucumber (Chinese Long) v2cumeB123
MELO3C003510Cucumber (Chinese Long) v2cumeB222
MELO3C003510Cucumber (Chinese Long) v2cumeB482
MELO3C003510Watermelon (Charleston Gray)mewcgB322
MELO3C003510Watermelon (Charleston Gray)mewcgB325
MELO3C003510Watermelon (Charleston Gray)mewcgB353
MELO3C003510Watermelon (97103) v1mewmB352
MELO3C003510Watermelon (97103) v1mewmB377
MELO3C003510Watermelon (97103) v1mewmB387
MELO3C003510Cucurbita pepo (Zucchini)cpemeB521
MELO3C003510Cucurbita pepo (Zucchini)cpemeB728
MELO3C003510Cucurbita pepo (Zucchini)cpemeB770
MELO3C003510Bottle gourd (USVL1VR-Ls)lsimeB143
MELO3C003510Bottle gourd (USVL1VR-Ls)lsimeB310
MELO3C003510Bottle gourd (USVL1VR-Ls)lsimeB481
MELO3C003510Cucumber (Gy14) v2cgybmeB107
MELO3C003510Cucumber (Gy14) v2cgybmeB185
MELO3C003510Cucumber (Gy14) v2cgybmeB423
MELO3C003510Silver-seed gourdcarmeB0631
MELO3C003510Silver-seed gourdcarmeB0666
MELO3C003510Silver-seed gourdcarmeB0817
MELO3C003510Cucumber (Chinese Long) v3cucmeB130
MELO3C003510Cucumber (Chinese Long) v3cucmeB219
MELO3C003510Cucumber (Chinese Long) v3cucmeB494
MELO3C003510Watermelon (97103) v2mewmbB314
MELO3C003510Watermelon (97103) v2mewmbB323
MELO3C003510Watermelon (97103) v2mewmbB356
MELO3C003510Wax gourdmewgoB435
MELO3C003510Melon (DHL92) v3.5.1memeB123
MELO3C003510Melon (DHL92) v3.5.1memeB144
MELO3C003510Cucumber (Gy14) v1cgymeB129
MELO3C003510Cucumber (Gy14) v1cgymeB279
MELO3C003510Cucumber (Gy14) v1cgymeB517