MELO3C001916 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTTCTGTCACCTATAACGTGAAATTTGTTCAGGTTGAAACTGTTGAAGGCTTGAAAGACCTCCAAATACCTGCTGGTGTTCAGCCAGGGGATAGAGTTAGATTGCCATTCATGGGGATTCCAGATATAAATAAACCTTCTGTTCGTGGTGATCATCTGTTTATTGTGAATGTTCAGATCCCGAAGCGTATCAGGTCCAGTTTTAACTATTATGATTTATGCCCCCCTCCCTCCTAG ATGAGTTCTGTCACCTATAACGTGAAATTTGTTCAGGTTGAAACTGTTGAAGGCTTGAAAGACCTCCAAATACCTGCTGGTGTTCAGCCAGGGGATAGAGTTAGATTGCCATTCATGGGGATTCCAGATATAAATAAACCTTCTGTTCGTGGTGATCATCTGTTTATTGTGAATGTTCAGATCCCGAAGCGTATCAGGTCCAGTTTTAACTATTATGATTTATGCCCCCCTCCCTCCTAG ATGAGTTCTGTCACCTATAACGTGAAATTTGTTCAGGTTGAAACTGTTGAAGGCTTGAAAGACCTCCAAATACCTGCTGGTGTTCAGCCAGGGGATAGAGTTAGATTGCCATTCATGGGGATTCCAGATATAAATAAACCTTCTGTTCGTGGTGATCATCTGTTTATTGTGAATGTTCAGATCCCGAAGCGTATCAGGTCCAGTTTTAACTATTATGATTTATGCCCCCCTCCCTCCTAG MSSVTYNVKFVQVETVEGLKDLQIPAGVQPGDRVRLPFMGIPDINKPSVRGDHLFIVNVQIPKRIRSSFNYYDLCPPPS*
BLAST of MELO3C001916 vs. Swiss-Prot
Match: DNAJ1_SYNY3 (Chaperone protein DnaJ 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dnaJ1 PE=3 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 3.8e-08 Identity = 27/57 (47.37%), Postives = 35/57 (61.40%), Query Frame = 1
BLAST of MELO3C001916 vs. Swiss-Prot
Match: DNAJ_CYAA5 (Chaperone protein DnaJ OS=Cyanothece sp. (strain ATCC 51142) GN=dnaJ PE=3 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.1e-07 Identity = 26/57 (45.61%), Postives = 35/57 (61.40%), Query Frame = 1
BLAST of MELO3C001916 vs. Swiss-Prot
Match: DNAJ_THEEB (Chaperone protein DnaJ OS=Thermosynechococcus elongatus (strain BP-1) GN=dnaJ PE=3 SV=2) HSP 1 Score: 56.2 bits (134), Expect = 1.9e-07 Identity = 26/55 (47.27%), Postives = 33/55 (60.00%), Query Frame = 1
BLAST of MELO3C001916 vs. Swiss-Prot
Match: DNAJ_SYNP2 (Chaperone protein DnaJ OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=dnaJ PE=3 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 1.9e-07 Identity = 26/55 (47.27%), Postives = 34/55 (61.82%), Query Frame = 1
BLAST of MELO3C001916 vs. Swiss-Prot
Match: DNJA6_ARATH (Chaperone protein dnaJ A6, chloroplastic OS=Arabidopsis thaliana GN=DJA6 PE=2 SV=2) HSP 1 Score: 55.5 bits (132), Expect = 3.2e-07 Identity = 25/55 (45.45%), Postives = 36/55 (65.45%), Query Frame = 1
BLAST of MELO3C001916 vs. TrEMBL
Match: A0A0A0LVB1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G031210 PE=4 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 2.3e-20 Identity = 52/58 (89.66%), Postives = 54/58 (93.10%), Query Frame = 1
BLAST of MELO3C001916 vs. TrEMBL
Match: A0A0B0PQB5_GOSAR (Chaperone DnaJ OS=Gossypium arboreum GN=F383_08552 PE=3 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 2.0e-16 Identity = 45/66 (68.18%), Postives = 54/66 (81.82%), Query Frame = 1
BLAST of MELO3C001916 vs. TrEMBL
Match: W9QWM5_9ROSA (Chaperone protein DnaJ OS=Morus notabilis GN=L484_019309 PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 5.8e-16 Identity = 41/58 (70.69%), Postives = 51/58 (87.93%), Query Frame = 1
BLAST of MELO3C001916 vs. TrEMBL
Match: A0A061G300_THECC (Molecular chaperone Hsp40/DnaJ family protein OS=Theobroma cacao GN=TCM_046739 PE=3 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 7.6e-16 Identity = 42/55 (76.36%), Postives = 49/55 (89.09%), Query Frame = 1
BLAST of MELO3C001916 vs. TrEMBL
Match: V4WE73_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10008033mg PE=3 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.3e-15 Identity = 42/55 (76.36%), Postives = 49/55 (89.09%), Query Frame = 1
BLAST of MELO3C001916 vs. TAIR10
Match: AT3G17830.1 (AT3G17830.1 Molecular chaperone Hsp40/DnaJ family protein) HSP 1 Score: 77.0 bits (188), Expect = 5.8e-15 Identity = 32/54 (59.26%), Postives = 41/54 (75.93%), Query Frame = 1
BLAST of MELO3C001916 vs. TAIR10
Match: AT1G80030.1 (AT1G80030.1 Molecular chaperone Hsp40/DnaJ family protein) HSP 1 Score: 68.6 bits (166), Expect = 2.1e-12 Identity = 31/55 (56.36%), Postives = 40/55 (72.73%), Query Frame = 1
BLAST of MELO3C001916 vs. TAIR10
Match: AT2G22360.1 (AT2G22360.1 DNAJ heat shock family protein) HSP 1 Score: 55.5 bits (132), Expect = 1.8e-08 Identity = 25/55 (45.45%), Postives = 36/55 (65.45%), Query Frame = 1
BLAST of MELO3C001916 vs. TAIR10
Match: AT4G39960.1 (AT4G39960.1 Molecular chaperone Hsp40/DnaJ family protein) HSP 1 Score: 54.3 bits (129), Expect = 4.0e-08 Identity = 25/55 (45.45%), Postives = 35/55 (63.64%), Query Frame = 1
BLAST of MELO3C001916 vs. NCBI nr
Match: gi|659066226|ref|XP_008441271.1| (PREDICTED: chaperone protein dnaJ 1, mitochondrial isoform X3 [Cucumis melo]) HSP 1 Score: 113.2 bits (282), Expect = 2.1e-22 Identity = 55/58 (94.83%), Postives = 56/58 (96.55%), Query Frame = 1
BLAST of MELO3C001916 vs. NCBI nr
Match: gi|659066224|ref|XP_008440493.1| (PREDICTED: chaperone protein dnaJ 1, mitochondrial isoform X2 [Cucumis melo]) HSP 1 Score: 113.2 bits (282), Expect = 2.1e-22 Identity = 55/58 (94.83%), Postives = 56/58 (96.55%), Query Frame = 1
BLAST of MELO3C001916 vs. NCBI nr
Match: gi|659066222|ref|XP_008439676.1| (PREDICTED: chaperone protein dnaJ 1, mitochondrial isoform X1 [Cucumis melo]) HSP 1 Score: 113.2 bits (282), Expect = 2.1e-22 Identity = 55/58 (94.83%), Postives = 56/58 (96.55%), Query Frame = 1
BLAST of MELO3C001916 vs. NCBI nr
Match: gi|778656703|ref|XP_011649542.1| (PREDICTED: dnaJ homolog subfamily A member 3, mitochondrial isoform X3 [Cucumis sativus]) HSP 1 Score: 105.9 bits (263), Expect = 3.3e-20 Identity = 52/58 (89.66%), Postives = 54/58 (93.10%), Query Frame = 1
BLAST of MELO3C001916 vs. NCBI nr
Match: gi|700208850|gb|KGN63946.1| (hypothetical protein Csa_1G031210 [Cucumis sativus]) HSP 1 Score: 105.9 bits (263), Expect = 3.3e-20 Identity = 52/58 (89.66%), Postives = 54/58 (93.10%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|