Lsi11G015140 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTTCATCAACAAGAGCTTGGGTTGTAGCCACCACTGTGGGCGTCGTGGAAGCCTTAAAGGATCAAGGAATTTGCCGATGGAATCAAACCATTAGATCGGCGCATCAATACGCTAAAAATCATGTCAGATCGGTGCCTCAGGCCACCAGATTGACTGGCTCTTCCGCCGCCGTGGTTTCCGGCAAGCAACAGCAGAAGCAATCGGAAGAATCTTTTAGAACCGTCATGTATTTGAGCTGTTGGGGTCCCAATTAA ATGAGTTCATCAACAAGAGCTTGGGTTGTAGCCACCACTGTGGGCGTCGTGGAAGCCTTAAAGGATCAAGGAATTTGCCGATGGAATCAAACCATTAGATCGGCGCATCAATACGCTAAAAATCATGTCAGATCGGTGCCTCAGGCCACCAGATTGACTGGCTCTTCCGCCGCCGTGGTTTCCGGCAAGCAACAGCAGAAGCAATCGGAAGAATCTTTTAGAACCGTCATGTATTTGAGCTGTTGGGGTCCCAATTAA ATGAGTTCATCAACAAGAGCTTGGGTTGTAGCCACCACTGTGGGCGTCGTGGAAGCCTTAAAGGATCAAGGAATTTGCCGATGGAATCAAACCATTAGATCGGCGCATCAATACGCTAAAAATCATGTCAGATCGGTGCCTCAGGCCACCAGATTGACTGGCTCTTCCGCCGCCGTGGTTTCCGGCAAGCAACAGCAGAAGCAATCGGAAGAATCTTTTAGAACCGTCATGTATTTGAGCTGTTGGGGTCCCAATTAA MSSSTRAWVVATTVGVVEALKDQGICRWNQTIRSAHQYAKNHVRSVPQATRLTGSSAAVVSGKQQQKQSEESFRTVMYLSCWGPN
BLAST of Lsi11G015140 vs. TrEMBL
Match: A0A0A0K296_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G046660 PE=4 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 6.4e-29 Identity = 68/75 (90.67%), Postives = 70/75 (93.33%), Query Frame = 1
BLAST of Lsi11G015140 vs. TrEMBL
Match: A0A0D2RIR4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G205800 PE=4 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 1.9e-25 Identity = 59/86 (68.60%), Postives = 71/86 (82.56%), Query Frame = 1
BLAST of Lsi11G015140 vs. TrEMBL
Match: A0A0D2N5Q5_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G205900 PE=4 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 1.9e-25 Identity = 60/86 (69.77%), Postives = 69/86 (80.23%), Query Frame = 1
BLAST of Lsi11G015140 vs. TrEMBL
Match: A0A0D2PKH2_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G206000 PE=4 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 4.3e-25 Identity = 60/86 (69.77%), Postives = 69/86 (80.23%), Query Frame = 1
BLAST of Lsi11G015140 vs. TrEMBL
Match: A0A0B0NEB0_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_15200 PE=4 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 2.1e-24 Identity = 59/86 (68.60%), Postives = 67/86 (77.91%), Query Frame = 1
BLAST of Lsi11G015140 vs. TAIR10
Match: AT4G10265.1 (AT4G10265.1 Wound-responsive family protein) HSP 1 Score: 102.4 bits (254), Expect = 1.4e-22 Identity = 50/86 (58.14%), Postives = 67/86 (77.91%), Query Frame = 1
BLAST of Lsi11G015140 vs. TAIR10
Match: AT4G10270.1 (AT4G10270.1 Wound-responsive family protein) HSP 1 Score: 100.9 bits (250), Expect = 4.0e-22 Identity = 52/90 (57.78%), Postives = 68/90 (75.56%), Query Frame = 1
BLAST of Lsi11G015140 vs. TAIR10
Match: AT4G33560.1 (AT4G33560.1 Wound-responsive family protein) HSP 1 Score: 57.4 bits (137), Expect = 5.0e-09 Identity = 31/83 (37.35%), Postives = 42/83 (50.60%), Query Frame = 1
BLAST of Lsi11G015140 vs. NCBI nr
Match: gi|778723985|ref|XP_011658732.1| (PREDICTED: uncharacterized protein LOC101213259 [Cucumis sativus]) HSP 1 Score: 159.8 bits (403), Expect = 2.0e-36 Identity = 78/85 (91.76%), Postives = 80/85 (94.12%), Query Frame = 1
BLAST of Lsi11G015140 vs. NCBI nr
Match: gi|659110683|ref|XP_008455356.1| (PREDICTED: uncharacterized protein LOC103495543 [Cucumis melo]) HSP 1 Score: 156.4 bits (394), Expect = 2.3e-35 Identity = 76/85 (89.41%), Postives = 79/85 (92.94%), Query Frame = 1
BLAST of Lsi11G015140 vs. NCBI nr
Match: gi|700188345|gb|KGN43578.1| (hypothetical protein Csa_7G046660 [Cucumis sativus]) HSP 1 Score: 134.4 bits (337), Expect = 9.2e-29 Identity = 68/75 (90.67%), Postives = 70/75 (93.33%), Query Frame = 1
BLAST of Lsi11G015140 vs. NCBI nr
Match: gi|659110681|ref|XP_008455355.1| (PREDICTED: uncharacterized protein LOC103495542 [Cucumis melo]) HSP 1 Score: 123.2 bits (308), Expect = 2.1e-25 Identity = 62/85 (72.94%), Postives = 68/85 (80.00%), Query Frame = 1
BLAST of Lsi11G015140 vs. NCBI nr
Match: gi|823159828|ref|XP_012479750.1| (PREDICTED: uncharacterized protein LOC105794909 [Gossypium raimondii]) HSP 1 Score: 122.9 bits (307), Expect = 2.8e-25 Identity = 59/86 (68.60%), Postives = 71/86 (82.56%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |