Lsi10G004510 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGATTCGGTTTCTATCTTTGGTTCCTCATGCCAAGCAAATTCTGAAGATGCAGTCAGGTTTCACCAAAAACCAGTTGGATGTTCCAAAAGGCCATGTGGCAGTTTATGTAGGAGAAATCCAAATGAAGCGGTTCGTGGTTCCAATATCTTACCTAAACCATCCGTCGTTTCAACAACTGCTCAGCCACGCAGAGGAAGAGTTTGGCTTCCATCATCCTAAAGGAGGCCTAACAATTCCTTGCAAAGAAGATGCCTTCATTGATCTCACTTCTAGATTGCAAGTAGCTTGA ATGGGGATTCGGTTTCTATCTTTGGTTCCTCATGCCAAGCAAATTCTGAAGATGCAGTCAGGTTTCACCAAAAACCAGTTGGATGTTCCAAAAGGCCATGTGGCAGTTTATGTAGGAGAAATCCAAATGAAGCGGTTCGTGGTTCCAATATCTTACCTAAACCATCCGTCGTTTCAACAACTGCTCAGCCACGCAGAGGAAGAGTTTGGCTTCCATCATCCTAAAGGAGGCCTAACAATTCCTTGCAAAGAAGATGCCTTCATTGATCTCACTTCTAGATTGCAAGTAGCTTGA ATGGGGATTCGGTTTCTATCTTTGGTTCCTCATGCCAAGCAAATTCTGAAGATGCAGTCAGGTTTCACCAAAAACCAGTTGGATGTTCCAAAAGGCCATGTGGCAGTTTATGTAGGAGAAATCCAAATGAAGCGGTTCGTGGTTCCAATATCTTACCTAAACCATCCGTCGTTTCAACAACTGCTCAGCCACGCAGAGGAAGAGTTTGGCTTCCATCATCCTAAAGGAGGCCTAACAATTCCTTGCAAAGAAGATGCCTTCATTGATCTCACTTCTAGATTGCAAGTAGCTTGA MGIRFLSLVPHAKQILKMQSGFTKNQLDVPKGHVAVYVGEIQMKRFVVPISYLNHPSFQQLLSHAEEEFGFHHPKGGLTIPCKEDAFIDLTSRLQVA
BLAST of Lsi10G004510 vs. Swiss-Prot
Match: SAU24_ARATH (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana GN=SAUR24 PE=2 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.3e-23 Identity = 54/84 (64.29%), Postives = 63/84 (75.00%), Query Frame = 1
BLAST of Lsi10G004510 vs. Swiss-Prot
Match: SAU20_ARATH (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana GN=SAUR20 PE=2 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 6.6e-23 Identity = 52/79 (65.82%), Postives = 59/79 (74.68%), Query Frame = 1
BLAST of Lsi10G004510 vs. Swiss-Prot
Match: SAU22_ARATH (Auxin-responsive protein SAUR22 OS=Arabidopsis thaliana GN=SAUR22 PE=2 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.5e-22 Identity = 48/66 (72.73%), Postives = 56/66 (84.85%), Query Frame = 1
BLAST of Lsi10G004510 vs. Swiss-Prot
Match: AX6B_SOYBN (Auxin-induced protein 6B OS=Glycine max PE=2 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 1.9e-22 Identity = 51/81 (62.96%), Postives = 63/81 (77.78%), Query Frame = 1
BLAST of Lsi10G004510 vs. Swiss-Prot
Match: SAU21_ARATH (Auxin-responsive protein SAUR21 OS=Arabidopsis thaliana GN=SAUR21 PE=2 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 2.5e-22 Identity = 48/66 (72.73%), Postives = 56/66 (84.85%), Query Frame = 1
BLAST of Lsi10G004510 vs. TrEMBL
Match: A0A0A0LPI0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258720 PE=4 SV=1) HSP 1 Score: 188.3 bits (477), Expect = 4.3e-45 Identity = 90/97 (92.78%), Postives = 92/97 (94.85%), Query Frame = 1
BLAST of Lsi10G004510 vs. TrEMBL
Match: A0A0A0LLF1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258700 PE=4 SV=1) HSP 1 Score: 181.0 bits (458), Expect = 6.8e-43 Identity = 84/97 (86.60%), Postives = 91/97 (93.81%), Query Frame = 1
BLAST of Lsi10G004510 vs. TrEMBL
Match: A0A0A0LJA3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258790 PE=4 SV=1) HSP 1 Score: 179.9 bits (455), Expect = 1.5e-42 Identity = 86/97 (88.66%), Postives = 91/97 (93.81%), Query Frame = 1
BLAST of Lsi10G004510 vs. TrEMBL
Match: A0A0A0LIZ9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258760 PE=4 SV=1) HSP 1 Score: 179.9 bits (455), Expect = 1.5e-42 Identity = 83/97 (85.57%), Postives = 91/97 (93.81%), Query Frame = 1
BLAST of Lsi10G004510 vs. TrEMBL
Match: A0A0A0LJ99_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258740 PE=4 SV=1) HSP 1 Score: 177.9 bits (450), Expect = 5.8e-42 Identity = 84/97 (86.60%), Postives = 89/97 (91.75%), Query Frame = 1
BLAST of Lsi10G004510 vs. TAIR10
Match: AT4G38840.1 (AT4G38840.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 119.8 bits (299), Expect = 9.4e-28 Identity = 59/97 (60.82%), Postives = 71/97 (73.20%), Query Frame = 1
BLAST of Lsi10G004510 vs. TAIR10
Match: AT4G34810.1 (AT4G34810.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 117.1 bits (292), Expect = 6.1e-27 Identity = 61/105 (58.10%), Postives = 76/105 (72.38%), Query Frame = 1
BLAST of Lsi10G004510 vs. TAIR10
Match: AT2G21210.1 (AT2G21210.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 116.3 bits (290), Expect = 1.0e-26 Identity = 57/98 (58.16%), Postives = 72/98 (73.47%), Query Frame = 1
BLAST of Lsi10G004510 vs. TAIR10
Match: AT5G18080.1 (AT5G18080.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 110.2 bits (274), Expect = 7.5e-25 Identity = 54/84 (64.29%), Postives = 63/84 (75.00%), Query Frame = 1
BLAST of Lsi10G004510 vs. TAIR10
Match: AT4G34790.1 (AT4G34790.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 110.2 bits (274), Expect = 7.5e-25 Identity = 57/102 (55.88%), Postives = 71/102 (69.61%), Query Frame = 1
BLAST of Lsi10G004510 vs. NCBI nr
Match: gi|659115596|ref|XP_008457635.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 189.9 bits (481), Expect = 2.1e-45 Identity = 89/97 (91.75%), Postives = 94/97 (96.91%), Query Frame = 1
BLAST of Lsi10G004510 vs. NCBI nr
Match: gi|700206757|gb|KGN61876.1| (hypothetical protein Csa_2G258720 [Cucumis sativus]) HSP 1 Score: 188.3 bits (477), Expect = 6.1e-45 Identity = 90/97 (92.78%), Postives = 92/97 (94.85%), Query Frame = 1
BLAST of Lsi10G004510 vs. NCBI nr
Match: gi|659115592|ref|XP_008457632.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 184.1 bits (466), Expect = 1.2e-43 Identity = 88/97 (90.72%), Postives = 92/97 (94.85%), Query Frame = 1
BLAST of Lsi10G004510 vs. NCBI nr
Match: gi|778674175|ref|XP_011650154.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 181.0 bits (458), Expect = 9.8e-43 Identity = 84/97 (86.60%), Postives = 91/97 (93.81%), Query Frame = 1
BLAST of Lsi10G004510 vs. NCBI nr
Match: gi|700206761|gb|KGN61880.1| (hypothetical protein Csa_2G258760 [Cucumis sativus]) HSP 1 Score: 179.9 bits (455), Expect = 2.2e-42 Identity = 83/97 (85.57%), Postives = 91/97 (93.81%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |