Lsi10G004410 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGATTTCGTCTACCGTCTATTCTCTTTAGTGCCAAGCAAATTCTCAGAACACAGTCCATTTCTGGGAGATGTCAATCCAGTGTTCCTAAAGGTCACATCGCAGTATACGTGGGAGAAATTCAGAGGACTCGGTTTTTGGTTCCGATATCTTACTTGAACCATCCTTCATTTTTAGACTTGCTAAGGAGGGCTGAAGAAGAGTTTGGATTCAACCATCCAACAGGAGGGTTGACCATTCCCTGCAAAGAAGAAGCTTTCATTGATGTCACTTCTAGACTGCACACTTCATGA ATGGGATTTCGTCTACCGTCTATTCTCTTTAGTGCCAAGCAAATTCTCAGAACACAGTCCATTTCTGGGAGATGTCAATCCAGTGTTCCTAAAGGTCACATCGCAGTATACGTGGGAGAAATTCAGAGGACTCGGTTTTTGGTTCCGATATCTTACTTGAACCATCCTTCATTTTTAGACTTGCTAAGGAGGGCTGAAGAAGAGTTTGGATTCAACCATCCAACAGGAGGGTTGACCATTCCCTGCAAAGAAGAAGCTTTCATTGATGTCACTTCTAGACTGCACACTTCATGA ATGGGATTTCGTCTACCGTCTATTCTCTTTAGTGCCAAGCAAATTCTCAGAACACAGTCCATTTCTGGGAGATGTCAATCCAGTGTTCCTAAAGGTCACATCGCAGTATACGTGGGAGAAATTCAGAGGACTCGGTTTTTGGTTCCGATATCTTACTTGAACCATCCTTCATTTTTAGACTTGCTAAGGAGGGCTGAAGAAGAGTTTGGATTCAACCATCCAACAGGAGGGTTGACCATTCCCTGCAAAGAAGAAGCTTTCATTGATGTCACTTCTAGACTGCACACTTCATGA MGFRLPSILFSAKQILRTQSISGRCQSSVPKGHIAVYVGEIQRTRFLVPISYLNHPSFLDLLRRAEEEFGFNHPTGGLTIPCKEEAFIDVTSRLHTS
BLAST of Lsi10G004410 vs. Swiss-Prot
Match: SAU23_ARATH (Auxin-responsive protein SAUR23 OS=Arabidopsis thaliana GN=SAUR23 PE=2 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 4.6e-24 Identity = 55/87 (63.22%), Postives = 66/87 (75.86%), Query Frame = 1
BLAST of Lsi10G004410 vs. Swiss-Prot
Match: SAU24_ARATH (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana GN=SAUR24 PE=2 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.0e-23 Identity = 53/86 (61.63%), Postives = 66/86 (76.74%), Query Frame = 1
BLAST of Lsi10G004410 vs. Swiss-Prot
Match: AX10A_SOYBN (Auxin-induced protein X10A OS=Glycine max PE=2 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 1.7e-23 Identity = 57/99 (57.58%), Postives = 69/99 (69.70%), Query Frame = 1
BLAST of Lsi10G004410 vs. Swiss-Prot
Match: SAU20_ARATH (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana GN=SAUR20 PE=2 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 3.9e-23 Identity = 54/85 (63.53%), Postives = 64/85 (75.29%), Query Frame = 1
BLAST of Lsi10G004410 vs. Swiss-Prot
Match: SAU22_ARATH (Auxin-responsive protein SAUR22 OS=Arabidopsis thaliana GN=SAUR22 PE=2 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 5.0e-23 Identity = 53/86 (61.63%), Postives = 65/86 (75.58%), Query Frame = 1
BLAST of Lsi10G004410 vs. TrEMBL
Match: A0A0A0LIZ4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258710 PE=4 SV=1) HSP 1 Score: 195.3 bits (495), Expect = 3.5e-47 Identity = 93/97 (95.88%), Postives = 95/97 (97.94%), Query Frame = 1
BLAST of Lsi10G004410 vs. TrEMBL
Match: A0A0A0LM65_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258730 PE=4 SV=1) HSP 1 Score: 169.1 bits (427), Expect = 2.7e-39 Identity = 79/97 (81.44%), Postives = 87/97 (89.69%), Query Frame = 1
BLAST of Lsi10G004410 vs. TrEMBL
Match: A0A0A0LPH3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258670 PE=4 SV=1) HSP 1 Score: 168.3 bits (425), Expect = 4.6e-39 Identity = 74/97 (76.29%), Postives = 88/97 (90.72%), Query Frame = 1
BLAST of Lsi10G004410 vs. TrEMBL
Match: A0A0A0LLF7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258750 PE=4 SV=1) HSP 1 Score: 166.4 bits (420), Expect = 1.7e-38 Identity = 78/97 (80.41%), Postives = 85/97 (87.63%), Query Frame = 1
BLAST of Lsi10G004410 vs. TrEMBL
Match: A0A0A0LPG7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258620 PE=4 SV=1) HSP 1 Score: 160.2 bits (404), Expect = 1.2e-36 Identity = 73/97 (75.26%), Postives = 84/97 (86.60%), Query Frame = 1
BLAST of Lsi10G004410 vs. TAIR10
Match: AT4G38840.1 (AT4G38840.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 122.9 bits (307), Expect = 1.1e-28 Identity = 59/99 (59.60%), Postives = 72/99 (72.73%), Query Frame = 1
BLAST of Lsi10G004410 vs. TAIR10
Match: AT2G21210.1 (AT2G21210.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 120.6 bits (301), Expect = 5.5e-28 Identity = 57/98 (58.16%), Postives = 76/98 (77.55%), Query Frame = 1
BLAST of Lsi10G004410 vs. TAIR10
Match: AT4G34810.1 (AT4G34810.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 116.3 bits (290), Expect = 1.0e-26 Identity = 59/104 (56.73%), Postives = 76/104 (73.08%), Query Frame = 1
BLAST of Lsi10G004410 vs. TAIR10
Match: AT5G18060.1 (AT5G18060.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 111.7 bits (278), Expect = 2.6e-25 Identity = 55/87 (63.22%), Postives = 66/87 (75.86%), Query Frame = 1
BLAST of Lsi10G004410 vs. TAIR10
Match: AT5G18080.1 (AT5G18080.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 110.5 bits (275), Expect = 5.7e-25 Identity = 53/86 (61.63%), Postives = 66/86 (76.74%), Query Frame = 1
BLAST of Lsi10G004410 vs. NCBI nr
Match: gi|659115590|ref|XP_008457631.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 197.2 bits (500), Expect = 1.3e-47 Identity = 93/97 (95.88%), Postives = 96/97 (98.97%), Query Frame = 1
BLAST of Lsi10G004410 vs. NCBI nr
Match: gi|449458550|ref|XP_004147010.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 195.3 bits (495), Expect = 5.0e-47 Identity = 93/97 (95.88%), Postives = 95/97 (97.94%), Query Frame = 1
BLAST of Lsi10G004410 vs. NCBI nr
Match: gi|659115586|ref|XP_008457629.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 170.6 bits (431), Expect = 1.3e-39 Identity = 76/97 (78.35%), Postives = 89/97 (91.75%), Query Frame = 1
BLAST of Lsi10G004410 vs. NCBI nr
Match: gi|778669591|ref|XP_011649272.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 169.1 bits (427), Expect = 3.8e-39 Identity = 79/97 (81.44%), Postives = 87/97 (89.69%), Query Frame = 1
BLAST of Lsi10G004410 vs. NCBI nr
Match: gi|659115594|ref|XP_008457634.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 168.3 bits (425), Expect = 6.5e-39 Identity = 79/97 (81.44%), Postives = 86/97 (88.66%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |