Lsi10G001770 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGACTGAACTCCTCAACAATCCCAACGTACTAACTAAAGCCATAGTCGAGTTAGACACAATGGTTGGTCAAGATCGACCAATCAATGAACTTGATCTCACCAATCACAACTATCTTCAAGCCATTGTTGTCGAGACGCTCCGCCTCCATCCGCCAGCTCCGATGCTCATTCCACATTATTCCTCCGACAATTGTAACGTTGCTGGCTACGACATTCCACGTGGCACAATGCTATTGGTTAATGCTTGGGCGATACATCGAGACCGGAAGCTTTGGGAAAACCCGACGAACTTTCGGCCCGAGAGGTTCTTATGA ATGACTGAACTCCTCAACAATCCCAACGTACTAACTAAAGCCATAGTCGAGTTAGACACAATGGTTGGTCAAGATCGACCAATCAATGAACTTGATCTCACCAATCACAACTATCTTCAAGCCATTGTTGTCGAGACGCTCCGCCTCCATCCGCCAGCTCCGATGCTCATTCCACATTATTCCTCCGACAATTGTAACGTTGCTGGCTACGACATTCCACGTGGCACAATGCTATTGGTTAATGCTTGGGCGATACATCGAGACCGGAAGCTTTGGGAAAACCCGACGAACTTTCGGCCCGAGAGGTTCTTATGA ATGACTGAACTCCTCAACAATCCCAACGTACTAACTAAAGCCATAGTCGAGTTAGACACAATGGTTGGTCAAGATCGACCAATCAATGAACTTGATCTCACCAATCACAACTATCTTCAAGCCATTGTTGTCGAGACGCTCCGCCTCCATCCGCCAGCTCCGATGCTCATTCCACATTATTCCTCCGACAATTGTAACGTTGCTGGCTACGACATTCCACGTGGCACAATGCTATTGGTTAATGCTTGGGCGATACATCGAGACCGGAAGCTTTGGGAAAACCCGACGAACTTTCGGCCCGAGAGGTTCTTATGA MTELLNNPNVLTKAIVELDTMVGQDRPINELDLTNHNYLQAIVVETLRLHPPAPMLIPHYSSDNCNVAGYDIPRGTMLLVNAWAIHRDRKLWENPTNFRPERFL
BLAST of Lsi10G001770 vs. Swiss-Prot
Match: C8D11_ARATH (Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1) HSP 1 Score: 139.8 bits (351), Expect = 1.7e-32 Identity = 63/103 (61.17%), Postives = 78/103 (75.73%), Query Frame = 1
BLAST of Lsi10G001770 vs. Swiss-Prot
Match: C81D1_ARATH (Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 7.0e-31 Identity = 58/103 (56.31%), Postives = 79/103 (76.70%), Query Frame = 1
BLAST of Lsi10G001770 vs. Swiss-Prot
Match: C81E1_GLYEC (Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2) HSP 1 Score: 132.9 bits (333), Expect = 2.0e-30 Identity = 58/103 (56.31%), Postives = 77/103 (74.76%), Query Frame = 1
BLAST of Lsi10G001770 vs. Swiss-Prot
Match: C81E9_MEDTR (Isoflavone 3'-hydroxylase (Fragment) OS=Medicago truncatula GN=CYP81E9 PE=1 SV=1) HSP 1 Score: 131.7 bits (330), Expect = 4.6e-30 Identity = 55/103 (53.40%), Postives = 79/103 (76.70%), Query Frame = 1
BLAST of Lsi10G001770 vs. Swiss-Prot
Match: C81E8_MEDTR (Cytochrome P450 81E8 OS=Medicago truncatula GN=CYP81E8 PE=2 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 7.8e-30 Identity = 57/103 (55.34%), Postives = 79/103 (76.70%), Query Frame = 1
BLAST of Lsi10G001770 vs. TrEMBL
Match: K7NC01_SIRGR (Cytochrome P450 OS=Siraitia grosvenorii GN=P450-1 PE=2 SV=1) HSP 1 Score: 167.5 bits (423), Expect = 8.3e-39 Identity = 77/104 (74.04%), Postives = 88/104 (84.62%), Query Frame = 1
BLAST of Lsi10G001770 vs. TrEMBL
Match: A0A0A0LQK7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G425760 PE=3 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 1.6e-37 Identity = 75/104 (72.12%), Postives = 87/104 (83.65%), Query Frame = 1
BLAST of Lsi10G001770 vs. TrEMBL
Match: A0A0B2PZ51_GLYSO (Cytochrome P450 81D1 OS=Glycine soja GN=glysoja_027252 PE=3 SV=1) HSP 1 Score: 151.0 bits (380), Expect = 8.1e-34 Identity = 68/103 (66.02%), Postives = 81/103 (78.64%), Query Frame = 1
BLAST of Lsi10G001770 vs. TrEMBL
Match: A0A0R0HCC8_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_11G051800 PE=3 SV=1) HSP 1 Score: 151.0 bits (380), Expect = 8.1e-34 Identity = 68/103 (66.02%), Postives = 81/103 (78.64%), Query Frame = 1
BLAST of Lsi10G001770 vs. TrEMBL
Match: K7LN57_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 151.0 bits (380), Expect = 8.1e-34 Identity = 68/103 (66.02%), Postives = 81/103 (78.64%), Query Frame = 1
BLAST of Lsi10G001770 vs. TAIR10
Match: AT4G37360.1 (AT4G37360.1 cytochrome P450, family 81, subfamily D, polypeptide 2) HSP 1 Score: 143.7 bits (361), Expect = 6.5e-35 Identity = 65/103 (63.11%), Postives = 80/103 (77.67%), Query Frame = 1
BLAST of Lsi10G001770 vs. TAIR10
Match: AT3G28740.1 (AT3G28740.1 Cytochrome P450 superfamily protein) HSP 1 Score: 139.8 bits (351), Expect = 9.4e-34 Identity = 63/103 (61.17%), Postives = 78/103 (75.73%), Query Frame = 1
BLAST of Lsi10G001770 vs. TAIR10
Match: AT4G37330.1 (AT4G37330.1 cytochrome P450, family 81, subfamily D, polypeptide 4) HSP 1 Score: 139.0 bits (349), Expect = 1.6e-33 Identity = 59/103 (57.28%), Postives = 82/103 (79.61%), Query Frame = 1
BLAST of Lsi10G001770 vs. TAIR10
Match: AT4G37320.1 (AT4G37320.1 cytochrome P450, family 81, subfamily D, polypeptide 5) HSP 1 Score: 138.7 bits (348), Expect = 2.1e-33 Identity = 60/103 (58.25%), Postives = 76/103 (73.79%), Query Frame = 1
BLAST of Lsi10G001770 vs. TAIR10
Match: AT4G37370.1 (AT4G37370.1 cytochrome P450, family 81, subfamily D, polypeptide 8) HSP 1 Score: 137.9 bits (346), Expect = 3.6e-33 Identity = 60/103 (58.25%), Postives = 83/103 (80.58%), Query Frame = 1
BLAST of Lsi10G001770 vs. NCBI nr
Match: gi|659111597|ref|XP_008455812.1| (PREDICTED: isoflavone 2'-hydroxylase-like [Cucumis melo]) HSP 1 Score: 168.7 bits (426), Expect = 5.4e-39 Identity = 77/104 (74.04%), Postives = 89/104 (85.58%), Query Frame = 1
BLAST of Lsi10G001770 vs. NCBI nr
Match: gi|343466197|gb|AEM42992.1| (cytochrome P450 [Siraitia grosvenorii]) HSP 1 Score: 167.5 bits (423), Expect = 1.2e-38 Identity = 77/104 (74.04%), Postives = 88/104 (84.62%), Query Frame = 1
BLAST of Lsi10G001770 vs. NCBI nr
Match: gi|700208180|gb|KGN63299.1| (hypothetical protein Csa_2G425760 [Cucumis sativus]) HSP 1 Score: 163.3 bits (412), Expect = 2.3e-37 Identity = 75/104 (72.12%), Postives = 87/104 (83.65%), Query Frame = 1
BLAST of Lsi10G001770 vs. NCBI nr
Match: gi|449468317|ref|XP_004151868.1| (PREDICTED: cytochrome P450 81E8-like [Cucumis sativus]) HSP 1 Score: 163.3 bits (412), Expect = 2.3e-37 Identity = 75/104 (72.12%), Postives = 87/104 (83.65%), Query Frame = 1
BLAST of Lsi10G001770 vs. NCBI nr
Match: gi|571487382|ref|XP_006590643.1| (PREDICTED: cytochrome P450 81E8 [Glycine max]) HSP 1 Score: 151.0 bits (380), Expect = 1.2e-33 Identity = 68/103 (66.02%), Postives = 81/103 (78.64%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|