Lsi09G010630 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: five_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.TTTGGCTATGGAGTCGGGAAGGAGAATATGCAATGGGTTGCATGCTGCCAAACCAGCCATTCTCATGGCTTTGGTTCAATCGATTAATGCAGCAGTTAATGTTCTCTACAAATTAGCTGTTAATGATGGAATGAATTTGATGATCCTCATTGCTTTTCGTTTCGTGTTTGCATCCCTTTTCATGCTTCCTCTTGCCTTCTTTCTCGAAAGGTTTTTTATTTTTTATTTTTTATTTTTTATTTCTTCTTCTTCTTTCGATCTTTTGTATGGAAAGGGATAGTGGTTAATATAATGTGAGTTTTTTCTTTACATTGTCCATCGCAGAAATAAAAGGCCGAAGATGACATGGTCGGTGCTCTTCTATGGATTTTTCTGTGGATTATTTGGG TTTGGCTATGGAGTCGGGAAGGAGAATATGCAATGGGTTGCATGCTGCCAAACCAGCCATTCTCATGGCTTTGGTTCAATCGATTAATGCAGCAGTTAATGTTCTCTACAAATTAGCTGTTAATGATGGAATGAATTTGATGATCCTCATTGCTTTTCGTTTCGTGTTTGCATCCCTTTTCATGCTTCCTCTTGCCTTCTTTCTCGAAAGAAATAAAAGGCCGAAGATGACATGGTCGGTGCTCTTCTATGGATTTTTCTGTGGATTATTTGGG ATGGAGTCGGGAAGGAGAATATGCAATGGGTTGCATGCTGCCAAACCAGCCATTCTCATGGCTTTGGTTCAATCGATTAATGCAGCAGTTAATGTTCTCTACAAATTAGCTGTTAATGATGGAATGAATTTGATGATCCTCATTGCTTTTCGTTTCGTGTTTGCATCCCTTTTCATGCTTCCTCTTGCCTTCTTTCTCGAAAGAAATAAAAGGCCGAAGATGACATGGTCGGTGCTCTTCTATGGATTTTTCTGTGGATTATTTGGG MESGRRICNGLHAAKPAILMALVQSINAAVNVLYKLAVNDGMNLMILIAFRFVFASLFMLPLAFFLERNKRPKMTWSVLFYGFFCGLFG
BLAST of Lsi09G010630 vs. Swiss-Prot
Match: WTR6_ARATH (WAT1-related protein At1g25270 OS=Arabidopsis thaliana GN=At1g25270 PE=2 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 6.3e-12 Identity = 35/75 (46.67%), Postives = 49/75 (65.33%), Query Frame = 1
BLAST of Lsi09G010630 vs. Swiss-Prot
Match: WTR10_ARATH (WAT1-related protein At1g68170 OS=Arabidopsis thaliana GN=At1g68170 PE=3 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 4.5e-10 Identity = 31/75 (41.33%), Postives = 47/75 (62.67%), Query Frame = 1
BLAST of Lsi09G010630 vs. Swiss-Prot
Match: WTR2_ARATH (WAT1-related protein At1g09380 OS=Arabidopsis thaliana GN=At1g09380 PE=2 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 2.9e-09 Identity = 33/74 (44.59%), Postives = 48/74 (64.86%), Query Frame = 1
BLAST of Lsi09G010630 vs. Swiss-Prot
Match: WTR24_ARATH (WAT1-related protein At3g30340 OS=Arabidopsis thaliana GN=At3g30340 PE=2 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.6e-07 Identity = 27/75 (36.00%), Postives = 47/75 (62.67%), Query Frame = 1
BLAST of Lsi09G010630 vs. Swiss-Prot
Match: WTR39_ARATH (WAT1-related protein At5g13670 OS=Arabidopsis thaliana GN=At5g13670 PE=2 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 4.6e-07 Identity = 29/75 (38.67%), Postives = 46/75 (61.33%), Query Frame = 1
BLAST of Lsi09G010630 vs. TrEMBL
Match: A0A0A0LNI5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G151070 PE=4 SV=1) HSP 1 Score: 153.7 bits (387), Expect = 1.1e-34 Identity = 75/87 (86.21%), Postives = 80/87 (91.95%), Query Frame = 1
BLAST of Lsi09G010630 vs. TrEMBL
Match: A0A162AHC3_DAUCA (Uncharacterized protein OS=Daucus carota subsp. sativus GN=DCAR_001812 PE=4 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 1.6e-22 Identity = 54/84 (64.29%), Postives = 67/84 (79.76%), Query Frame = 1
BLAST of Lsi09G010630 vs. TrEMBL
Match: W9RV49_9ROSA (WAT1-related protein OS=Morus notabilis GN=L484_024170 PE=3 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 3.0e-21 Identity = 54/86 (62.79%), Postives = 64/86 (74.42%), Query Frame = 1
BLAST of Lsi09G010630 vs. TrEMBL
Match: A0A0B2QYH3_GLYSO (WAT1-related protein OS=Glycine soja GN=glysoja_011303 PE=3 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 6.7e-21 Identity = 52/83 (62.65%), Postives = 65/83 (78.31%), Query Frame = 1
BLAST of Lsi09G010630 vs. TrEMBL
Match: I1KUH2_SOYBN (WAT1-related protein OS=Glycine max GN=GLYMA_08G182700 PE=3 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 6.7e-21 Identity = 52/83 (62.65%), Postives = 65/83 (78.31%), Query Frame = 1
BLAST of Lsi09G010630 vs. TAIR10
Match: AT1G25270.1 (AT1G25270.1 nodulin MtN21 /EamA-like transporter family protein) HSP 1 Score: 71.2 bits (173), Expect = 3.5e-13 Identity = 35/75 (46.67%), Postives = 49/75 (65.33%), Query Frame = 1
BLAST of Lsi09G010630 vs. TAIR10
Match: AT1G68170.1 (AT1G68170.1 nodulin MtN21 /EamA-like transporter family protein) HSP 1 Score: 65.1 bits (157), Expect = 2.5e-11 Identity = 31/75 (41.33%), Postives = 47/75 (62.67%), Query Frame = 1
BLAST of Lsi09G010630 vs. TAIR10
Match: AT1G09380.1 (AT1G09380.1 nodulin MtN21 /EamA-like transporter family protein) HSP 1 Score: 62.4 bits (150), Expect = 1.6e-10 Identity = 33/74 (44.59%), Postives = 48/74 (64.86%), Query Frame = 1
BLAST of Lsi09G010630 vs. TAIR10
Match: AT3G30340.1 (AT3G30340.1 nodulin MtN21 /EamA-like transporter family protein) HSP 1 Score: 56.6 bits (135), Expect = 9.0e-09 Identity = 27/75 (36.00%), Postives = 47/75 (62.67%), Query Frame = 1
BLAST of Lsi09G010630 vs. TAIR10
Match: AT5G13670.1 (AT5G13670.1 nodulin MtN21 /EamA-like transporter family protein) HSP 1 Score: 55.1 bits (131), Expect = 2.6e-08 Identity = 29/75 (38.67%), Postives = 46/75 (61.33%), Query Frame = 1
BLAST of Lsi09G010630 vs. NCBI nr
Match: gi|700206397|gb|KGN61516.1| (hypothetical protein Csa_2G151070 [Cucumis sativus]) HSP 1 Score: 153.7 bits (387), Expect = 1.5e-34 Identity = 75/87 (86.21%), Postives = 80/87 (91.95%), Query Frame = 1
BLAST of Lsi09G010630 vs. NCBI nr
Match: gi|659114726|ref|XP_008457201.1| (PREDICTED: WAT1-related protein At1g25270-like [Cucumis melo]) HSP 1 Score: 128.6 bits (322), Expect = 5.3e-27 Identity = 65/70 (92.86%), Postives = 67/70 (95.71%), Query Frame = 1
BLAST of Lsi09G010630 vs. NCBI nr
Match: gi|778668524|ref|XP_011649111.1| (PREDICTED: WAT1-related protein At1g25270-like [Cucumis sativus]) HSP 1 Score: 125.9 bits (315), Expect = 3.4e-26 Identity = 62/70 (88.57%), Postives = 66/70 (94.29%), Query Frame = 1
BLAST of Lsi09G010630 vs. NCBI nr
Match: gi|747090051|ref|XP_011092694.1| (PREDICTED: WAT1-related protein At1g68170-like [Sesamum indicum]) HSP 1 Score: 117.5 bits (293), Expect = 1.2e-23 Identity = 53/89 (59.55%), Postives = 70/89 (78.65%), Query Frame = 1
BLAST of Lsi09G010630 vs. NCBI nr
Match: gi|1021051378|gb|KZN09156.1| (hypothetical protein DCAR_001812 [Daucus carota subsp. sativus]) HSP 1 Score: 113.2 bits (282), Expect = 2.3e-22 Identity = 54/84 (64.29%), Postives = 67/84 (79.76%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|