Lsi09G006980 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTTTTCTCAAAAGCCTCAGAGGCTGTGGTTGCATCTGTTGCCTTAACTTTGGTGGCACTCTTAGTTTTTGGCTACGCCAAGGGTTACTTCACCGGCAATAGACCCGTCATGAGTGCCGTCCAAACCGCCCTCATCGGAGCCATAGCGTCATCGGCCGCCTTCGGCATGGCCAAGGCTGTCCAACCACGTCAACCCTAA ATGTTTTTCTCAAAAGCCTCAGAGGCTGTGGTTGCATCTGTTGCCTTAACTTTGGTGGCACTCTTAGTTTTTGGCTACGCCAAGGGTTACTTCACCGGCAATAGACCCGTCATGAGTGCCGTCCAAACCGCCCTCATCGGAGCCATAGCGTCATCGGCCGCCTTCGGCATGGCCAAGGCTGTCCAACCACGTCAACCCTAA ATGTTTTTCTCAAAAGCCTCAGAGGCTGTGGTTGCATCTGTTGCCTTAACTTTGGTGGCACTCTTAGTTTTTGGCTACGCCAAGGGTTACTTCACCGGCAATAGACCCGTCATGAGTGCCGTCCAAACCGCCCTCATCGGAGCCATAGCGTCATCGGCCGCCTTCGGCATGGCCAAGGCTGTCCAACCACGTCAACCCTAA MFFSKASEAVVASVALTLVALLVFGYAKGYFTGNRPVMSAVQTALIGAIASSAAFGMAKAVQPRQP
BLAST of Lsi09G006980 vs. Swiss-Prot
Match: VIT11_ORYSJ (Vacuolar iron transporter 1.1 OS=Oryza sativa subsp. japonica GN=VIT1.1 PE=2 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 4.1e-16 Identity = 45/64 (70.31%), Postives = 53/64 (82.81%), Query Frame = 1
BLAST of Lsi09G006980 vs. Swiss-Prot
Match: VIT12_ORYSJ (Vacuolar iron transporter 1.2 OS=Oryza sativa subsp. japonica GN=VIT1.2 PE=3 SV=2) HSP 1 Score: 77.8 bits (190), Expect = 5.0e-14 Identity = 42/62 (67.74%), Postives = 48/62 (77.42%), Query Frame = 1
BLAST of Lsi09G006980 vs. Swiss-Prot
Match: VIT1_ARATH (Vacuolar iron transporter 1 OS=Arabidopsis thaliana GN=VIT1 PE=2 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 9.3e-13 Identity = 39/62 (62.90%), Postives = 49/62 (79.03%), Query Frame = 1
BLAST of Lsi09G006980 vs. TrEMBL
Match: A0A0A0KSS5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G550250 PE=4 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 6.9e-23 Identity = 59/66 (89.39%), Postives = 65/66 (98.48%), Query Frame = 1
BLAST of Lsi09G006980 vs. TrEMBL
Match: V4U611_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10016475mg PE=4 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 2.2e-16 Identity = 48/61 (78.69%), Postives = 57/61 (93.44%), Query Frame = 1
BLAST of Lsi09G006980 vs. TrEMBL
Match: A0A067F3X4_CITSI (Uncharacterized protein (Fragment) OS=Citrus sinensis GN=CISIN_1g0263512mg PE=4 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 2.2e-16 Identity = 48/61 (78.69%), Postives = 57/61 (93.44%), Query Frame = 1
BLAST of Lsi09G006980 vs. TrEMBL
Match: A0A0S3QWI8_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.01G013600 PE=4 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 2.8e-16 Identity = 49/63 (77.78%), Postives = 56/63 (88.89%), Query Frame = 1
BLAST of Lsi09G006980 vs. TrEMBL
Match: A0A0L9T931_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan325s004800 PE=4 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 2.8e-16 Identity = 49/63 (77.78%), Postives = 56/63 (88.89%), Query Frame = 1
BLAST of Lsi09G006980 vs. TAIR10
Match: AT2G01770.1 (AT2G01770.1 vacuolar iron transporter 1) HSP 1 Score: 73.6 bits (179), Expect = 5.3e-14 Identity = 39/62 (62.90%), Postives = 49/62 (79.03%), Query Frame = 1
BLAST of Lsi09G006980 vs. NCBI nr
Match: gi|449450149|ref|XP_004142826.1| (PREDICTED: vacuolar iron transporter 1.1 [Cucumis sativus]) HSP 1 Score: 114.0 bits (284), Expect = 1.0e-22 Identity = 59/66 (89.39%), Postives = 65/66 (98.48%), Query Frame = 1
BLAST of Lsi09G006980 vs. NCBI nr
Match: gi|659072768|ref|XP_008467051.1| (PREDICTED: vacuolar iron transporter 1.1-like [Cucumis melo]) HSP 1 Score: 110.2 bits (274), Expect = 1.4e-21 Identity = 58/66 (87.88%), Postives = 63/66 (95.45%), Query Frame = 1
BLAST of Lsi09G006980 vs. NCBI nr
Match: gi|641841890|gb|KDO60800.1| (hypothetical protein CISIN_1g0263512mg, partial [Citrus sinensis]) HSP 1 Score: 92.4 bits (228), Expect = 3.1e-16 Identity = 48/61 (78.69%), Postives = 57/61 (93.44%), Query Frame = 1
BLAST of Lsi09G006980 vs. NCBI nr
Match: gi|567911647|ref|XP_006448137.1| (hypothetical protein CICLE_v10016475mg [Citrus clementina]) HSP 1 Score: 92.4 bits (228), Expect = 3.1e-16 Identity = 48/61 (78.69%), Postives = 57/61 (93.44%), Query Frame = 1
BLAST of Lsi09G006980 vs. NCBI nr
Match: gi|659129452|ref|XP_008464694.1| (PREDICTED: vacuolar iron transporter 1-like [Cucumis melo]) HSP 1 Score: 92.4 bits (228), Expect = 3.1e-16 Identity = 49/62 (79.03%), Postives = 53/62 (85.48%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|