Lsi08G006400 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACGCCCATTCCTCTTCCTTTTCAAGCTTTTCCGCCTACCTTCGAGCTCTCTCTCTAACCCCTTCTCGTCTTTCTCGCCGGGCTTTCTCTGTTTCCACCTCTTTCGATGAAATGACCACTACTCGATCCACTTCCGGCGTCGACATGCAGAGGACTCTCCGCTGGTTCGACCTCGTCGGTTTTGGCCTCGGTGGGATGATCGGTGCGGGGGTTTTCGTCACCACCGGTCCGGCTACACAGCAAGCTGGACCCGCCATTGTTCTCTCTTACGCCATTGCTGGCCTCTGTGCGCTTTTATCGGCGTTCTGCTACACTGAGTTCGCCGTCGATATGCCTGTTGCTGGTGGGGCCTTCAGTTACCTCCGTGTCACATTCGGTGTGGTTTCTTGA ATGGACGCCCATTCCTCTTCCTTTTCAAGCTTTTCCGCCTACCTTCGAGCTCTCTCTCTAACCCCTTCTCGTCTTTCTCGCCGGGCTTTCTCTGTTTCCACCTCTTTCGATGAAATGACCACTACTCGATCCACTTCCGGCGTCGACATGCAGAGGACTCTCCGCTGGTTCGACCTCGTCGGTTTTGGCCTCGGTGGGATGATCGGTGCGGGGGTTTTCGTCACCACCGGTCCGGCTACACAGCAAGCTGGACCCGCCATTGTTCTCTCTTACGCCATTGCTGGCCTCTGTGCGCTTTTATCGGCGTTCTGCTACACTGAGTTCGCCGTCGATATGCCTGTTGCTGGTGGGGCCTTCAGTTACCTCCGTGTCACATTCGGTGTGGTTTCTTGA ATGGACGCCCATTCCTCTTCCTTTTCAAGCTTTTCCGCCTACCTTCGAGCTCTCTCTCTAACCCCTTCTCGTCTTTCTCGCCGGGCTTTCTCTGTTTCCACCTCTTTCGATGAAATGACCACTACTCGATCCACTTCCGGCGTCGACATGCAGAGGACTCTCCGCTGGTTCGACCTCGTCGGTTTTGGCCTCGGTGGGATGATCGGTGCGGGGGTTTTCGTCACCACCGGTCCGGCTACACAGCAAGCTGGACCCGCCATTGTTCTCTCTTACGCCATTGCTGGCCTCTGTGCGCTTTTATCGGCGTTCTGCTACACTGAGTTCGCCGTCGATATGCCTGTTGCTGGTGGGGCCTTCAGTTACCTCCGTGTCACATTCGGTGTGGTTTCTTGA MDAHSSSFSSFSAYLRALSLTPSRLSRRAFSVSTSFDEMTTTRSTSGVDMQRTLRWFDLVGFGLGGMIGAGVFVTTGPATQQAGPAIVLSYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGVVS
BLAST of Lsi08G006400 vs. Swiss-Prot
Match: CAAT6_ARATH (Cationic amino acid transporter 6, chloroplastic OS=Arabidopsis thaliana GN=CAT6 PE=2 SV=1) HSP 1 Score: 174.9 bits (442), Expect = 5.9e-43 Identity = 91/123 (73.98%), Postives = 106/123 (86.18%), Query Frame = 1
BLAST of Lsi08G006400 vs. Swiss-Prot
Match: CAAT7_ARATH (Cationic amino acid transporter 7, chloroplastic OS=Arabidopsis thaliana GN=CAT7 PE=3 SV=1) HSP 1 Score: 172.6 bits (436), Expect = 2.9e-42 Identity = 90/123 (73.17%), Postives = 106/123 (86.18%), Query Frame = 1
BLAST of Lsi08G006400 vs. Swiss-Prot
Match: CAAT1_ARATH (Cationic amino acid transporter 1 OS=Arabidopsis thaliana GN=CAT1 PE=1 SV=1) HSP 1 Score: 123.6 bits (309), Expect = 1.6e-27 Identity = 64/122 (52.46%), Postives = 88/122 (72.13%), Query Frame = 1
BLAST of Lsi08G006400 vs. Swiss-Prot
Match: CAAT5_ARATH (Cationic amino acid transporter 5 OS=Arabidopsis thaliana GN=CAT5 PE=1 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 7.7e-27 Identity = 68/122 (55.74%), Postives = 85/122 (69.67%), Query Frame = 1
BLAST of Lsi08G006400 vs. Swiss-Prot
Match: CAAT8_ARATH (Cationic amino acid transporter 8, vacuolar OS=Arabidopsis thaliana GN=CAT8 PE=2 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.8e-23 Identity = 65/122 (53.28%), Postives = 80/122 (65.57%), Query Frame = 1
BLAST of Lsi08G006400 vs. TrEMBL
Match: A0A0A0KCF7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G046250 PE=4 SV=1) HSP 1 Score: 229.9 bits (585), Expect = 1.7e-57 Identity = 121/127 (95.28%), Postives = 122/127 (96.06%), Query Frame = 1
BLAST of Lsi08G006400 vs. TrEMBL
Match: M5WRL1_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa003270mg PE=4 SV=1) HSP 1 Score: 189.5 bits (480), Expect = 2.6e-45 Identity = 102/127 (80.31%), Postives = 114/127 (89.76%), Query Frame = 1
BLAST of Lsi08G006400 vs. TrEMBL
Match: A0A0R0IAD8_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_10G277700 PE=4 SV=1) HSP 1 Score: 188.3 bits (477), Expect = 5.7e-45 Identity = 97/123 (78.86%), Postives = 109/123 (88.62%), Query Frame = 1
BLAST of Lsi08G006400 vs. TrEMBL
Match: I1LF01_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 188.3 bits (477), Expect = 5.7e-45 Identity = 97/123 (78.86%), Postives = 109/123 (88.62%), Query Frame = 1
BLAST of Lsi08G006400 vs. TrEMBL
Match: A0A067LGI8_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_24133 PE=4 SV=1) HSP 1 Score: 186.0 bits (471), Expect = 2.8e-44 Identity = 95/128 (74.22%), Postives = 115/128 (89.84%), Query Frame = 1
BLAST of Lsi08G006400 vs. TAIR10
Match: AT5G04770.1 (AT5G04770.1 cationic amino acid transporter 6) HSP 1 Score: 174.9 bits (442), Expect = 3.3e-44 Identity = 91/123 (73.98%), Postives = 106/123 (86.18%), Query Frame = 1
BLAST of Lsi08G006400 vs. TAIR10
Match: AT3G10600.1 (AT3G10600.1 cationic amino acid transporter 7) HSP 1 Score: 172.6 bits (436), Expect = 1.6e-43 Identity = 90/123 (73.17%), Postives = 106/123 (86.18%), Query Frame = 1
BLAST of Lsi08G006400 vs. TAIR10
Match: AT4G21120.1 (AT4G21120.1 amino acid transporter 1) HSP 1 Score: 123.6 bits (309), Expect = 8.7e-29 Identity = 64/122 (52.46%), Postives = 88/122 (72.13%), Query Frame = 1
BLAST of Lsi08G006400 vs. TAIR10
Match: AT2G34960.1 (AT2G34960.1 cationic amino acid transporter 5) HSP 1 Score: 121.3 bits (303), Expect = 4.3e-28 Identity = 68/122 (55.74%), Postives = 85/122 (69.67%), Query Frame = 1
BLAST of Lsi08G006400 vs. TAIR10
Match: AT1G17120.1 (AT1G17120.1 cationic amino acid transporter 8) HSP 1 Score: 110.2 bits (274), Expect = 1.0e-24 Identity = 65/122 (53.28%), Postives = 80/122 (65.57%), Query Frame = 1
BLAST of Lsi08G006400 vs. NCBI nr
Match: gi|778710426|ref|XP_011656572.1| (PREDICTED: cationic amino acid transporter 7, chloroplastic [Cucumis sativus]) HSP 1 Score: 229.9 bits (585), Expect = 2.5e-57 Identity = 121/127 (95.28%), Postives = 122/127 (96.06%), Query Frame = 1
BLAST of Lsi08G006400 vs. NCBI nr
Match: gi|659113504|ref|XP_008456609.1| (PREDICTED: cationic amino acid transporter 6, chloroplastic [Cucumis melo]) HSP 1 Score: 228.0 bits (580), Expect = 9.3e-57 Identity = 120/127 (94.49%), Postives = 121/127 (95.28%), Query Frame = 1
BLAST of Lsi08G006400 vs. NCBI nr
Match: gi|225464416|ref|XP_002269556.1| (PREDICTED: cationic amino acid transporter 6, chloroplastic [Vitis vinifera]) HSP 1 Score: 194.9 bits (494), Expect = 8.8e-47 Identity = 105/129 (81.40%), Postives = 116/129 (89.92%), Query Frame = 1
BLAST of Lsi08G006400 vs. NCBI nr
Match: gi|595914171|ref|XP_007214662.1| (hypothetical protein PRUPE_ppa003270mg [Prunus persica]) HSP 1 Score: 189.5 bits (480), Expect = 3.7e-45 Identity = 102/127 (80.31%), Postives = 114/127 (89.76%), Query Frame = 1
BLAST of Lsi08G006400 vs. NCBI nr
Match: gi|955343862|ref|XP_014618268.1| (PREDICTED: cationic amino acid transporter 7, chloroplastic-like [Glycine max]) HSP 1 Score: 188.3 bits (477), Expect = 8.2e-45 Identity = 97/123 (78.86%), Postives = 109/123 (88.62%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |