Lsi07G014920 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCCCAAGCGATGACATTAAGGAAAAGAGCCTCGATGATAAAGCAATGGTTGAGTTTCGACAACTATAGAATGAGGTACATAGAAGAGATAATGAAAGATGGCATTAGAACAATCTCTATACCACGTTCGACGGGGAGCAATTTTGATCTCGTTGCGGTTGAAAGAAAACATAGCTCGTGTTTGGCGTTAGTTCAAGGATTGGTGCTTTGGAACGAGTGCATAGAACTTAGGGCAATCAGGAAGGTATTGGGCTCTTCAGATTTCACGGGTAATGTCATGATCTTGATTGTGCAACAATACACAAAAGTGGCTAATGGAGACCAAGAGAATCATAAAAAAACTTATCATTTTCATGGATAA ATGTCCCAAGCGATGACATTAAGGAAAAGAGCCTCGATGATAAAGCAATGGTTGAGTTTCGACAACTATAGAATGAGGTACATAGAAGAGATAATGAAAGATGGCATTAGAACAATCTCTATACCACGTTCGACGGGGAGCAATTTTGATCTCGTTGCGGTTGAAAGAAAACATAGCTCGTGTTTGGCGTTAGTTCAAGGATTGGTGCTTTGGAACGAGTGCATAGAACTTAGGGCAATCAGGAAGGTATTGGGCTCTTCAGATTTCACGGGTAATGTCATGATCTTGATTGTGCAACAATACACAAAAGTGGCTAATGGAGACCAAGAGAATCATAAAAAAACTTATCATTTTCATGGATAA ATGTCCCAAGCGATGACATTAAGGAAAAGAGCCTCGATGATAAAGCAATGGTTGAGTTTCGACAACTATAGAATGAGGTACATAGAAGAGATAATGAAAGATGGCATTAGAACAATCTCTATACCACGTTCGACGGGGAGCAATTTTGATCTCGTTGCGGTTGAAAGAAAACATAGCTCGTGTTTGGCGTTAGTTCAAGGATTGGTGCTTTGGAACGAGTGCATAGAACTTAGGGCAATCAGGAAGGTATTGGGCTCTTCAGATTTCACGGGTAATGTCATGATCTTGATTGTGCAACAATACACAAAAGTGGCTAATGGAGACCAAGAGAATCATAAAAAAACTTATCATTTTCATGGATAA MSQAMTLRKRASMIKQWLSFDNYRMRYIEEIMKDGIRTISIPRSTGSNFDLVAVERKHSSCLALVQGLVLWNECIELRAIRKVLGSSDFTGNVMILIVQQYTKVANGDQENHKKTYHFHG
BLAST of Lsi07G014920 vs. Swiss-Prot
Match: CHX15_ARATH (Cation/H(+) antiporter 15 OS=Arabidopsis thaliana GN=CHX15 PE=2 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 6.0e-10 Identity = 33/75 (44.00%), Postives = 44/75 (58.67%), Query Frame = 1
BLAST of Lsi07G014920 vs. Swiss-Prot
Match: CHX14_ARATH (Cation/H(+) antiporter 14 OS=Arabidopsis thaliana GN=CHX14 PE=2 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 2.3e-09 Identity = 31/82 (37.80%), Postives = 49/82 (59.76%), Query Frame = 1
BLAST of Lsi07G014920 vs. Swiss-Prot
Match: CHX13_ARATH (Cation/H(+) symporter 13 OS=Arabidopsis thaliana GN=CHX13 PE=1 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 8.7e-09 Identity = 29/77 (37.66%), Postives = 47/77 (61.04%), Query Frame = 1
BLAST of Lsi07G014920 vs. Swiss-Prot
Match: CHX23_ARATH (Cation/H(+) antiporter 23, chloroplastic OS=Arabidopsis thaliana GN=CHX23 PE=1 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 3.1e-06 Identity = 29/80 (36.25%), Postives = 46/80 (57.50%), Query Frame = 1
BLAST of Lsi07G014920 vs. TrEMBL
Match: A0A0A0L8L0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G560770 PE=4 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 9.3e-26 Identity = 61/95 (64.21%), Postives = 76/95 (80.00%), Query Frame = 1
BLAST of Lsi07G014920 vs. TrEMBL
Match: A0A0A0L8L4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G563310 PE=4 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 7.4e-23 Identity = 54/89 (60.67%), Postives = 71/89 (79.78%), Query Frame = 1
BLAST of Lsi07G014920 vs. TrEMBL
Match: A0A0A0LB31_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G564310 PE=4 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 1.2e-20 Identity = 53/79 (67.09%), Postives = 62/79 (78.48%), Query Frame = 1
BLAST of Lsi07G014920 vs. TrEMBL
Match: A0A0A0LHP9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G824910 PE=4 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 8.5e-19 Identity = 50/91 (54.95%), Postives = 66/91 (72.53%), Query Frame = 1
BLAST of Lsi07G014920 vs. TrEMBL
Match: M5WVS7_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa014992mg PE=4 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 1.4e-13 Identity = 41/96 (42.71%), Postives = 62/96 (64.58%), Query Frame = 1
BLAST of Lsi07G014920 vs. TAIR10
Match: AT2G13620.1 (AT2G13620.1 cation/hydrogen exchanger 15) HSP 1 Score: 65.1 bits (157), Expect = 3.4e-11 Identity = 33/75 (44.00%), Postives = 44/75 (58.67%), Query Frame = 1
BLAST of Lsi07G014920 vs. TAIR10
Match: AT1G06970.1 (AT1G06970.1 cation/hydrogen exchanger 14) HSP 1 Score: 63.2 bits (152), Expect = 1.3e-10 Identity = 31/82 (37.80%), Postives = 49/82 (59.76%), Query Frame = 1
BLAST of Lsi07G014920 vs. TAIR10
Match: AT2G30240.1 (AT2G30240.1 Cation/hydrogen exchanger family protein) HSP 1 Score: 61.2 bits (147), Expect = 4.9e-10 Identity = 29/77 (37.66%), Postives = 47/77 (61.04%), Query Frame = 1
BLAST of Lsi07G014920 vs. TAIR10
Match: AT1G05580.1 (AT1G05580.1 cation/H+ exchanger 23) HSP 1 Score: 52.8 bits (125), Expect = 1.7e-07 Identity = 29/80 (36.25%), Postives = 46/80 (57.50%), Query Frame = 1
BLAST of Lsi07G014920 vs. TAIR10
Match: AT2G31910.1 (AT2G31910.1 cation/H+ exchanger 21) HSP 1 Score: 50.8 bits (120), Expect = 6.6e-07 Identity = 28/90 (31.11%), Postives = 47/90 (52.22%), Query Frame = 1
BLAST of Lsi07G014920 vs. NCBI nr
Match: gi|659098590|ref|XP_008450215.1| (PREDICTED: cation/H(+) antiporter 15-like [Cucumis melo]) HSP 1 Score: 130.2 bits (326), Expect = 2.4e-27 Identity = 63/98 (64.29%), Postives = 79/98 (80.61%), Query Frame = 1
BLAST of Lsi07G014920 vs. NCBI nr
Match: gi|449467797|ref|XP_004151609.1| (PREDICTED: cation/H(+) antiporter 15-like [Cucumis sativus]) HSP 1 Score: 124.4 bits (311), Expect = 1.3e-25 Identity = 61/95 (64.21%), Postives = 76/95 (80.00%), Query Frame = 1
BLAST of Lsi07G014920 vs. NCBI nr
Match: gi|700203020|gb|KGN58153.1| (hypothetical protein Csa_3G560770 [Cucumis sativus]) HSP 1 Score: 124.4 bits (311), Expect = 1.3e-25 Identity = 61/95 (64.21%), Postives = 76/95 (80.00%), Query Frame = 1
BLAST of Lsi07G014920 vs. NCBI nr
Match: gi|659098427|ref|XP_008450134.1| (PREDICTED: cation/H(+) antiporter 15-like [Cucumis melo]) HSP 1 Score: 122.5 bits (306), Expect = 5.1e-25 Identity = 58/95 (61.05%), Postives = 76/95 (80.00%), Query Frame = 1
BLAST of Lsi07G014920 vs. NCBI nr
Match: gi|659098445|ref|XP_008450141.1| (PREDICTED: cation/H(+) antiporter 15-like [Cucumis melo]) HSP 1 Score: 119.0 bits (297), Expect = 5.6e-24 Identity = 60/95 (63.16%), Postives = 73/95 (76.84%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|