Lsi06G012960 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGGGGTCGATCTTGCCACCACCGGCACCATCGGGAATCACTGGCCTGACAATTTACTTAGCCGGTGCACAAGGGCAGGTGGTTGGTGGAGTCGTAGTGGGTGCGCTCATTGCTTCTGGTCCGGTCGTGATCATGGCAGCAACGTTCATGAACGCGACGTTTGACCGCCTGCCATCGGACGACGAAGAAGTGACCACCGCCATGCAGAGTCAACATTACGGCCAAAATGGGCGGAGCCACCACCACCTGGATGTTTCGGATCTGTATGGAATGCCACAGAATTTGATCACCAATAGTAGTCTTCCGCCGGAATTATACTCTTGGGCGGCGGCTGGTAGAACCATGTCAAAGACTTAA ATGTTGGGGTCGATCTTGCCACCACCGGCACCATCGGGAATCACTGGCCTGACAATTTACTTAGCCGGTGCACAAGGGCAGGTGGTTGGTGGAGTCGTAGTGGGTGCGCTCATTGCTTCTGGTCCGGTCGTGATCATGGCAGCAACGTTCATGAACGCGACGTTTGACCGCCTGCCATCGGACGACGAAGAAGTGACCACCGCCATGCAGAGTCAACATTACGGCCAAAATGGGCGGAGCCACCACCACCTGGATGTTTCGGATCTGTATGGAATGCCACAGAATTTGATCACCAATAGTAGTCTTCCGCCGGAATTATACTCTTGGGCGGCGGCTGGTAGAACCATGTCAAAGACTTAA ATGTTGGGGTCGATCTTGCCACCACCGGCACCATCGGGAATCACTGGCCTGACAATTTACTTAGCCGGTGCACAAGGGCAGGTGGTTGGTGGAGTCGTAGTGGGTGCGCTCATTGCTTCTGGTCCGGTCGTGATCATGGCAGCAACGTTCATGAACGCGACGTTTGACCGCCTGCCATCGGACGACGAAGAAGTGACCACCGCCATGCAGAGTCAACATTACGGCCAAAATGGGCGGAGCCACCACCACCTGGATGTTTCGGATCTGTATGGAATGCCACAGAATTTGATCACCAATAGTAGTCTTCCGCCGGAATTATACTCTTGGGCGGCGGCTGGTAGAACCATGTCAAAGACTTAA MLGSILPPPAPSGITGLTIYLAGAQGQVVGGVVVGALIASGPVVIMAATFMNATFDRLPSDDEEVTTAMQSQHYGQNGRSHHHLDVSDLYGMPQNLITNSSLPPELYSWAAAGRTMSKT
BLAST of Lsi06G012960 vs. Swiss-Prot
Match: AHL16_ARATH (AT-hook motif nuclear-localized protein 16 OS=Arabidopsis thaliana GN=AHL16 PE=1 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 4.1e-35 Identity = 79/118 (66.95%), Postives = 93/118 (78.81%), Query Frame = 1
BLAST of Lsi06G012960 vs. Swiss-Prot
Match: AHL18_ARATH (AT-hook motif nuclear-localized protein 18 OS=Arabidopsis thaliana GN=AHL18 PE=2 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 1.2e-18 Identity = 53/109 (48.62%), Postives = 68/109 (62.39%), Query Frame = 1
BLAST of Lsi06G012960 vs. Swiss-Prot
Match: AHL26_ARATH (AT-hook motif nuclear-localized protein 26 OS=Arabidopsis thaliana GN=AHL26 PE=2 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 2.1e-18 Identity = 52/113 (46.02%), Postives = 70/113 (61.95%), Query Frame = 1
BLAST of Lsi06G012960 vs. Swiss-Prot
Match: AHL22_ARATH (AT-hook motif nuclear-localized protein 22 OS=Arabidopsis thaliana GN=AHL22 PE=1 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 2.1e-18 Identity = 60/125 (48.00%), Postives = 72/125 (57.60%), Query Frame = 1
BLAST of Lsi06G012960 vs. Swiss-Prot
Match: AHL20_ARATH (AT-hook motif nuclear-localized protein 20 OS=Arabidopsis thaliana GN=AHL20 PE=2 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.3e-17 Identity = 55/121 (45.45%), Postives = 74/121 (61.16%), Query Frame = 1
BLAST of Lsi06G012960 vs. TrEMBL
Match: A0A0A0LS82_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G024960 PE=4 SV=1) HSP 1 Score: 224.2 bits (570), Expect = 8.6e-56 Identity = 113/119 (94.96%), Postives = 115/119 (96.64%), Query Frame = 1
BLAST of Lsi06G012960 vs. TrEMBL
Match: B9GT32_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0002s06030g PE=4 SV=2) HSP 1 Score: 183.0 bits (463), Expect = 2.2e-43 Identity = 94/119 (78.99%), Postives = 107/119 (89.92%), Query Frame = 1
BLAST of Lsi06G012960 vs. TrEMBL
Match: F6H5C6_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_12s0028g00070 PE=4 SV=1) HSP 1 Score: 182.6 bits (462), Expect = 2.9e-43 Identity = 95/119 (79.83%), Postives = 108/119 (90.76%), Query Frame = 1
BLAST of Lsi06G012960 vs. TrEMBL
Match: A0A067LQP5_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_10400 PE=4 SV=1) HSP 1 Score: 181.0 bits (458), Expect = 8.3e-43 Identity = 94/122 (77.05%), Postives = 108/122 (88.52%), Query Frame = 1
BLAST of Lsi06G012960 vs. TrEMBL
Match: A0A061DKQ7_THECC (AT-hook DNA-binding family protein OS=Theobroma cacao GN=TCM_001878 PE=4 SV=1) HSP 1 Score: 178.7 bits (452), Expect = 4.1e-42 Identity = 94/118 (79.66%), Postives = 104/118 (88.14%), Query Frame = 1
BLAST of Lsi06G012960 vs. TAIR10
Match: AT2G42940.1 (AT2G42940.1 Predicted AT-hook DNA-binding family protein) HSP 1 Score: 148.7 bits (374), Expect = 2.3e-36 Identity = 79/118 (66.95%), Postives = 93/118 (78.81%), Query Frame = 1
BLAST of Lsi06G012960 vs. TAIR10
Match: AT3G60870.1 (AT3G60870.1 AT-hook motif nuclear-localized protein 18) HSP 1 Score: 94.0 bits (232), Expect = 6.8e-20 Identity = 53/109 (48.62%), Postives = 68/109 (62.39%), Query Frame = 1
BLAST of Lsi06G012960 vs. TAIR10
Match: AT4G12050.1 (AT4G12050.1 Predicted AT-hook DNA-binding family protein) HSP 1 Score: 93.2 bits (230), Expect = 1.2e-19 Identity = 52/113 (46.02%), Postives = 70/113 (61.95%), Query Frame = 1
BLAST of Lsi06G012960 vs. TAIR10
Match: AT2G45430.1 (AT2G45430.1 AT-hook motif nuclear-localized protein 22) HSP 1 Score: 93.2 bits (230), Expect = 1.2e-19 Identity = 60/125 (48.00%), Postives = 72/125 (57.60%), Query Frame = 1
BLAST of Lsi06G012960 vs. TAIR10
Match: AT4G14465.1 (AT4G14465.1 AT-hook motif nuclear-localized protein 20) HSP 1 Score: 90.5 bits (223), Expect = 7.5e-19 Identity = 55/121 (45.45%), Postives = 74/121 (61.16%), Query Frame = 1
BLAST of Lsi06G012960 vs. NCBI nr
Match: gi|778656460|ref|XP_011649113.1| (PREDICTED: AT-hook motif nuclear-localized protein 16 [Cucumis sativus]) HSP 1 Score: 224.2 bits (570), Expect = 1.2e-55 Identity = 113/119 (94.96%), Postives = 115/119 (96.64%), Query Frame = 1
BLAST of Lsi06G012960 vs. NCBI nr
Match: gi|700208768|gb|KGN63864.1| (hypothetical protein Csa_1G024960 [Cucumis sativus]) HSP 1 Score: 224.2 bits (570), Expect = 1.2e-55 Identity = 113/119 (94.96%), Postives = 115/119 (96.64%), Query Frame = 1
BLAST of Lsi06G012960 vs. NCBI nr
Match: gi|659106919|ref|XP_008453469.1| (PREDICTED: putative DNA-binding protein ESCAROLA [Cucumis melo]) HSP 1 Score: 223.0 bits (567), Expect = 2.7e-55 Identity = 112/119 (94.12%), Postives = 115/119 (96.64%), Query Frame = 1
BLAST of Lsi06G012960 vs. NCBI nr
Match: gi|657976639|ref|XP_008380207.1| (PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]) HSP 1 Score: 184.9 bits (468), Expect = 8.3e-44 Identity = 95/119 (79.83%), Postives = 109/119 (91.60%), Query Frame = 1
BLAST of Lsi06G012960 vs. NCBI nr
Match: gi|1009126445|ref|XP_015880157.1| (PREDICTED: AT-hook motif nuclear-localized protein 16 [Ziziphus jujuba]) HSP 1 Score: 183.3 bits (464), Expect = 2.4e-43 Identity = 94/119 (78.99%), Postives = 108/119 (90.76%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |